F302312

General Info

Members Datasets Scaffolds Average Seq Length
196 162 392 396

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2997451912|2997453819
Length 453
Sequence TPAVRERALSLRAEELPAYIYDLGALRAHMAEVRAALPERVELYYAAKANPEPEILAALRPYVDGYEVSSGGELAHVGKAVPDAPLAFGGPGKTPKEITQALEIGVRRFHVESVYELHMLAGLAADLAPERRIAVLARFNLPVDDGSLDGSSLAMGGRPTPFGLDPEQADEVVALLTDGTYPNLELVGVHAHLASGLEAPEQLAVSEAIVTWAAQLAWRHRVGLSEVTIGGGMAVDYAAPERRFDWPAYGAGLARLAAAHPALTLRIEPGRALTAYCGWYATEVLDVKHSHGEEFAVVRGGTHHLRTPATKGHDQPCTVLRSDEPWPHPWPRSAARGDRVTVTGQLCTPKDVLSRDVPAPGLRSGDRVVFGVAGAYAWNISHHDFLMHPHPEFHFLDSAGGVEGSAGGVDGAGEVALGAVEGVVSGTAEDVVVGRAERVHGRGERLLGMVEDG

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
8 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
9 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
10 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
14 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
15 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
20 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
21 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
22 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
23 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
24 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
25 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
26 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
27 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
37 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
40 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
41 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
42 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
43 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
44 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
45 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
46 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
47 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
48 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
49 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
50 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
51 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
52 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
53 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
54 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
55 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
56 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
57 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
58 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
59 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
60 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
61 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
62 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
63 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
64 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
65 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
66 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
67 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
68 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
69 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
70 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
71 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
72 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
73 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
74 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
75 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
76 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
77 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
78 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
79 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
80 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
81 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
82 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
83 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
115 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
116 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
117 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
118 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
119 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
120 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
121 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
122 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
125 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
126 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
127 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
131 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
132 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
133 2643221548 Streptomyces sp. Root55 Isolate Unclassified
134 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
135 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
136 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
137 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
138 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
139 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
140 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
141 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
142 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
143 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
144 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
145 2867369537 Streptomyces sp. Z26 Isolate Unclassified
146 2867475112 Streptomyces sp. TM32 Isolate Unclassified
147 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
148 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
149 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
150 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
151 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
152 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
153 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
154 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
155 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
156 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
157 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
158 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
159 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
160 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
161 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
162 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.67
Metatranscriptomes 0
Isolates 16.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.22
Nodule 1.02
Rhizoplane 4.08
Rhizosphere 62.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005585 3300001989 Bacteria 4770
2 rootH1_10005029 3300003316 Bacteria 23039
3 rootH2_10226886 3300003320 Bacteria 2965
4 Ga0070709_10004326 3300005434 Bacteria 7655
5 Ga0070709_10044627 3300005434 Bacteria 2746
6 Ga0070714_100089699 3300005435 Bacteria 2691
7 Ga0070707_100015634 3300005468 Bacteria 7122
8 Ga0070699_100000584 3300005518 Bacteria 34457
9 Ga0070702_100000792 3300005615 Bacteria 12038
10 Ga0068864_100114368 3300005618 Bacteria 2406
11 Ga0068864_100138678 3300005618 Bacteria 2192
12 Ga0068863_100038054 3300005841 Bacteria 4578
13 Ga0070717_10016673 3300006028 Bacteria 5700
14 Ga0075363_100095480 3300006048 Bacteria 1640
15 Ga0070715_10020159 3300006163 Bacteria 2568
16 Ga0070716_100016894 3300006173 Bacteria 3774
17 Ga0070716_100096706 3300006173 Bacteria 1801
18 Ga0070712_100182728 3300006175 Bacteria 1635
19 Ga0075370_10093061 3300006353 Bacteria 1740
20 Ga0105242_10047567 3300009176 Bacteria 3483
21 Ga0157370_10361909 3300013104 Bacteria 1337
22 Ga0157369_10341859 3300013105 Bacteria 1554
23 Ga0163163_10172479 3300014325 Bacteria 2210
24 Ga0157380_10107539 3300014326 Bacteria 2336
25 Ga0182008_10001939 3300014497 Bacteria 13357
26 Ga0157379_10056550 3300014968 Bacteria 3505
27 Ga0182007_10004821 3300015262 Bacteria 6043
28 Ga0213875_10005071 3300021388 Bacteria 7131
29 Ga0207426_1002338 3300025302 Bacteria 12379
30 Ga0207426_1006661 3300025302 Bacteria 4965
31 Ga0207426_1010258 3300025302 Bacteria 3645
32 Ga0207647_10013278 3300025904 Bacteria 5717
33 Ga0207699_10057354 3300025906 Bacteria 2325
34 Ga0207693_10077055 3300025915 Bacteria 2611
35 Ga0207646_10005471 3300025922 Bacteria 13351
36 Ga0207700_10141000 3300025928 Bacteria 1980
37 Ga0207686_10015192 3300025934 Bacteria 4301
38 Ga0207665_10011315 3300025939 Bacteria 5858
39 Ga0207665_10014080 3300025939 Bacteria 5262
40 Ga0207641_10002508 3300026088 Bacteria 16935
41 Ga0207683_10049178 3300026121 Bacteria 3691
42 Ga0307517_10004044 3300028786 Bacteria 22675
43 Ga0307512_10067766 3300030522 Bacteria 2683
44 Ga0307513_10000135 3300031456 Bacteria 103254
45 Ga0307513_10000350 3300031456 Bacteria 67174
46 Ga0307513_10039737 3300031456 Bacteria 5212
47 Ga0307508_10011214 3300031616 Bacteria 8198
48 Ga0307514_10056237 3300031649 Bacteria 3020
49 Ga0316214_1001747 3300033545 Bacteria 2591
50 Ga0316212_1002210 3300033547 Bacteria 2757
51 Ga0373935_0145255 3300035692 Bacteria 1605
52 Ga0373933_0033305 3300035724 Bacteria 2996
53 Ga0436364_0992631 3300037853 Bacteria 7134
54 Ga0439436_0003262 3300041404 Bacteria 4919
55 Ga0451837_1374716 3300041494 Bacteria 3276
56 Ga0451853_3353424 3300041512 Bacteria 1894
57 Ga0451853_3726170 3300041512 Bacteria 2656
58 Ga0439457_001533 3300042014 Bacteria 6932
59 Ga0439457_003002 3300042014 Bacteria 4689
60 Ga0439458_0001219 3300042157 Bacteria 6499
61 Ga0495629_0078681 3300046459 Bacteria 2302
62 Ga0495638_0043396 3300046460 Bacteria 2837
63 Ga0495651_0077595 3300046462 Bacteria 2514
64 Ga0495585_0105159 3300046492 Bacteria 1506
65 Ga0495608_0033071 3300046511 Bacteria 3497
66 Ga0495643_0006484 3300046522 Bacteria 7702
67 Ga0495640_0014388 3300046533 Bacteria 5990
68 Ga0495645_0002474 3300046543 Bacteria 12551
69 Ga0495633_0072950 3300046558 Bacteria 1600
70 Ga0495625_0046246 3300046660 Bacteria 3142
71 Ga0495635_0052094 3300046663 Bacteria 2819
72 Ga0495670_0002233 3300046691 Bacteria 9565
73 Ga0495589_0039375 3300046794 Bacteria 2362
74 Ga0495604_0014554 3300047317 Bacteria 6274
75 Ga0495680_0008479 3300047322 Bacteria 9340
76 Ga0495680_0170244 3300047322 Bacteria 1577
77 Ga0495685_004317 3300047447 Bacteria 4584
78 Ga0495681_0007159 3300047470 Bacteria 7175
79 Ga0495686_0012071 3300047472 Bacteria 6068
80 Ga0496100_0003168 3300048903 Bacteria 8534
81 Ga0496102_0000232 3300048905 Bacteria 73055
82 Ga0496103_0000149 3300048906 Bacteria 72642
83 Ga0496105_0035560 3300048908 Bacteria 4100
84 Ga0496108_0282013 3300048911 Bacteria 1446
85 Ga0496109_0193726 3300048912 Bacteria 1910
86 Ga0496110_0057627 3300048913 Bacteria 3420
87 Ga0496116_0000350 3300048919 Bacteria 72652
88 Ga0496117_0000262 3300048920 Bacteria 99623
89 Ga0496118_0000217 3300048921 Bacteria 100056
90 Ga0496119_0005845 3300048922 Bacteria 11624
91 Ga0496120_0004905 3300048923 Bacteria 10891
92 Ga0496121_0083288 3300048924 Bacteria 2525
93 Ga0496124_0054963 3300048927 Bacteria 3367
94 Ga0496126_0000177 3300048929 Bacteria 145158
95 Ga0496126_0012639 3300048929 Bacteria 8639
96 Ga0501031_0000688 3300049568 Bacteria 20160
97 Ga0501032_0000508 3300049569 Bacteria 31555
98 Ga0501032_0005281 3300049569 Bacteria 9606
99 Ga0501033_0115404 3300049570 Bacteria 1951
100 Ga0501034_0001988 3300049571 Bacteria 25876
101 Ga0501034_0002482 3300049571 Bacteria 22160
102 Ga0501034_0323306 3300049571 Bacteria 1475
103 Ga0501036_0001496 3300049572 Bacteria 18016
104 Ga0501036_0006921 3300049572 Bacteria 9218
105 Ga0501036_0017106 3300049572 Bacteria 6060
106 Ga0501037_0000799 3300049573 Bacteria 23659
107 Ga0501037_0012816 3300049573 Bacteria 6178
108 Ga0501038_0001181 3300049574 Bacteria 23704
109 Ga0501038_0002265 3300049574 Bacteria 17903
110 Ga0501039_0027117 3300049575 Bacteria 4404
111 Ga0501040_0003369 3300049576 Bacteria 10318
112 Ga0501041_0004346 3300049577 Bacteria 8196
113 Ga0501042_0162625 3300049578 Bacteria 1610
114 Ga0501043_0002888 3300049579 Bacteria 14350
115 Ga0501046_0001064 3300049580 Bacteria 26894
116 Ga0501047_0000823 3300049581 Bacteria 32143
117 Ga0501047_0002947 3300049581 Bacteria 16127
118 Ga0501047_0024120 3300049581 Bacteria 5842
119 Ga0501047_0158798 3300049581 Bacteria 2133
120 Ga0501048_0001884 3300049582 Bacteria 15918
121 Ga0501048_0026721 3300049582 Bacteria 4201
122 Ga0501067_0003147 3300049583 Bacteria 9113
123 Ga0501068_0001302 3300049584 Bacteria 13226
124 Ga0501069_0017060 3300049585 Bacteria 3903
125 Ga0501070_0001989 3300049586 Bacteria 17961
126 Ga0501070_0167408 3300049586 Bacteria 1811
127 Ga0501071_0000372 3300049587 Bacteria 21999
128 Ga0501072_0008973 3300049588 Bacteria 7603
129 Ga0501073_0036416 3300049589 Bacteria 3496
130 Ga0501074_0001601 3300049590 Bacteria 15352
131 Ga0501074_0053841 3300049590 Bacteria 2902
132 Ga0501076_0003435 3300049592 Bacteria 11115
133 Ga0501076_0116849 3300049592 Bacteria 2159
134 Ga0501077_0008801 3300049593 Bacteria 6264
135 Ga0501079_0022203 3300049741 Bacteria 4864
136 Ga0501083_0001444 3300049744 Bacteria 16225
137 Ga0501035_0000812 3300049822 Bacteria 33315
138 Ga0501035_0005206 3300049822 Bacteria 12308
139 Ga0501044_0001218 3300049823 Bacteria 30546
140 Ga0501044_0011961 3300049823 Bacteria 9405
141 Ga0501044_0017668 3300049823 Bacteria 7649
142 Ga0501044_0136185 3300049823 Bacteria 2447
143 Ga0501044_0205185 3300049823 Bacteria 1928
144 Ga0501045_0021364 3300049824 Bacteria 4629
145 nmdc:mga07m45_127461_c1 3300050496 Bacteria 1472
146 Ga0500578_0003768 3300053086 Bacteria 11145
147 Ga0500646_0008267 3300053090 Bacteria 2662
148 Ga0500654_020617 3300053099 Bacteria 4219
149 Ga0500614_011781 3300053123 Bacteria 1899
150 Ga0500628_002069 3300053129 Bacteria 3366
151 Ga0500652_001120 3300053131 Bacteria 8619
152 Ga0500561_0000717 3300053137 Bacteria 5267
153 Ga0500600_0016290 3300053149 Bacteria 4499
154 Ga0500600_0049794 3300053149 Bacteria 2380
155 Ga0500616_0000146 3300053153 Bacteria 119628
156 Ga0500616_0003308 3300053153 Bacteria 12432
157 Ga0500616_0009779 3300053153 Bacteria 5786
158 Ga0500633_0000466 3300053160 Bacteria 6422
159 Ga0500634_0006268 3300053161 Bacteria 5740
160 Ga0500656_000102 3300053732 Bacteria 4822
161 Ga0500587_000357 3300053739 Bacteria 5191
162 Ga0501084_0029186 3300054114 Bacteria 4613
163 Ga0501082_0003871 3300060353 Bacteria 13071
164 Ga0530510_0029000 3300061734 Bacteria 3970
165 2997453819 2997451912 Bacteria 8492419
166 2643737490 2643221543 Bacteria 6628015
167 2643760664 2643221548 Bacteria 8053412
168 2643942766 2643221587 Bacteria 7586415
169 2644019686 2643221601 Bacteria 7493239
170 2644180426 2643221631 Bacteria 8168043
171 2644430225 2643221677 Bacteria 7584031
172 2649118798 2648501241 Bacteria 5312320
173 2652974282 2651869818 Bacteria 5864031
174 2785346852 2784746763 Bacteria 9783172
175 2786674295 2786546132 Bacteria 10419719
176 2793983924 2791355406 Bacteria 11364898
177 2811843059 2808606982 Bacteria 7791042
178 2862387671 2862382967 Bacteria 10317375
179 2867369703 2867369537 Bacteria 6501581
180 2867478132 2867475112 Bacteria 6909112
181 2954009234 2954002825 Bacteria 9173742
182 2954681116 2954673503 Bacteria 9685905
183 2954683041 2954682443 Bacteria 9862841
184 2990061039 2990059506 Bacteria 9321252
185 2990091206 2990088156 Bacteria 6657676
186 2997601893 2997600082 Bacteria 9896405
187 3006323399 3006321560 Bacteria 8247479
188 8002749223 8002745576 Bacteria 4840272
189 8008560368 8008558824 Bacteria 10610750
190 8025478763 8025478263 Bacteria 8209203
191 8047899998 8047893842 Bacteria 11723082
192 8048132918 8048127548 Bacteria 11053136
193 8048358930 8048356638 Bacteria 11044339
194 8048376947 8048369669 Bacteria 11666822
195 8048386000 8048379754 Bacteria 11877923
196 8056448336 8056447290 Bacteria 7680491
197 JGI24739J22299_10005585
198 rootH1_10005029
199 rootH2_10226886
200 Ga0070709_10004326
201 Ga0070709_10044627
202 Ga0070714_100089699
203 Ga0070707_100015634
204 Ga0070699_100000584
205 Ga0070702_100000792
206 Ga0068864_100114368
207 Ga0068864_100138678
208 Ga0068863_100038054
209 Ga0070717_10016673
210 Ga0075363_100095480
211 Ga0070715_10020159
212 Ga0070716_100016894
213 Ga0070716_100096706
214 Ga0070712_100182728
215 Ga0075370_10093061
216 Ga0105242_10047567
217 Ga0157370_10361909
218 Ga0157369_10341859
219 Ga0163163_10172479
220 Ga0157380_10107539
221 Ga0182008_10001939
222 Ga0157379_10056550
223 Ga0182007_10004821
224 Ga0213875_10005071
225 Ga0207426_1002338
226 Ga0207426_1006661
227 Ga0207426_1010258
228 Ga0207647_10013278
229 Ga0207699_10057354
230 Ga0207693_10077055
231 Ga0207646_10005471
232 Ga0207700_10141000
233 Ga0207686_10015192
234 Ga0207665_10011315
235 Ga0207665_10014080
236 Ga0207641_10002508
237 Ga0207683_10049178
238 Ga0307517_10004044
239 Ga0307512_10067766
240 Ga0307513_10000135
241 Ga0307513_10000350
242 Ga0307513_10039737
243 Ga0307508_10011214
244 Ga0307514_10056237
245 Ga0316214_1001747
246 Ga0316212_1002210
247 Ga0373935_0145255
248 Ga0373933_0033305
249 Ga0436364_0992631
250 Ga0439436_0003262
251 Ga0451837_1374716
252 Ga0451853_3353424
253 Ga0451853_3726170
254 Ga0439457_001533
255 Ga0439457_003002
256 Ga0439458_0001219
257 Ga0495629_0078681
258 Ga0495638_0043396
259 Ga0495651_0077595
260 Ga0495585_0105159
261 Ga0495608_0033071
262 Ga0495643_0006484
263 Ga0495640_0014388
264 Ga0495645_0002474
265 Ga0495633_0072950
266 Ga0495625_0046246
267 Ga0495635_0052094
268 Ga0495670_0002233
269 Ga0495589_0039375
270 Ga0495604_0014554
271 Ga0495680_0008479
272 Ga0495680_0170244
273 Ga0495685_004317
274 Ga0495681_0007159
275 Ga0495686_0012071
276 Ga0496100_0003168
277 Ga0496102_0000232
278 Ga0496103_0000149
279 Ga0496105_0035560
280 Ga0496108_0282013
281 Ga0496109_0193726
282 Ga0496110_0057627
283 Ga0496116_0000350
284 Ga0496117_0000262
285 Ga0496118_0000217
286 Ga0496119_0005845
287 Ga0496120_0004905
288 Ga0496121_0083288
289 Ga0496124_0054963
290 Ga0496126_0000177
291 Ga0496126_0012639
292 Ga0501031_0000688
293 Ga0501032_0000508
294 Ga0501032_0005281
295 Ga0501033_0115404
296 Ga0501034_0001988
297 Ga0501034_0002482
298 Ga0501034_0323306
299 Ga0501036_0001496
300 Ga0501036_0006921
301 Ga0501036_0017106
302 Ga0501037_0000799
303 Ga0501037_0012816
304 Ga0501038_0001181
305 Ga0501038_0002265
306 Ga0501039_0027117
307 Ga0501040_0003369
308 Ga0501041_0004346
309 Ga0501042_0162625
310 Ga0501043_0002888
311 Ga0501046_0001064
312 Ga0501047_0000823
313 Ga0501047_0002947
314 Ga0501047_0024120
315 Ga0501047_0158798
316 Ga0501048_0001884
317 Ga0501048_0026721
318 Ga0501067_0003147
319 Ga0501068_0001302
320 Ga0501069_0017060
321 Ga0501070_0001989
322 Ga0501070_0167408
323 Ga0501071_0000372
324 Ga0501072_0008973
325 Ga0501073_0036416
326 Ga0501074_0001601
327 Ga0501074_0053841
328 Ga0501076_0003435
329 Ga0501076_0116849
330 Ga0501077_0008801
331 Ga0501079_0022203
332 Ga0501083_0001444
333 Ga0501035_0000812
334 Ga0501035_0005206
335 Ga0501044_0001218
336 Ga0501044_0011961
337 Ga0501044_0017668
338 Ga0501044_0136185
339 Ga0501044_0205185
340 Ga0501045_0021364
341 nmdc:mga07m45_127461_c1
342 Ga0500578_0003768
343 Ga0500646_0008267
344 Ga0500654_020617
345 Ga0500614_011781
346 Ga0500628_002069
347 Ga0500652_001120
348 Ga0500561_0000717
349 Ga0500600_0016290
350 Ga0500600_0049794
351 Ga0500616_0000146
352 Ga0500616_0003308
353 Ga0500616_0009779
354 Ga0500633_0000466
355 Ga0500634_0006268
356 Ga0500656_000102
357 Ga0500587_000357
358 Ga0501084_0029186
359 Ga0501082_0003871
360 Ga0530510_0029000
361 2997453819
362 2643737490
363 2643760664
364 2643942766
365 2644019686
366 2644180426
367 2644430225
368 2649118798
369 2652974282
370 2785346852
371 2786674295
372 2793983924
373 2811843059
374 2862387671
375 2867369703
376 2867478132
377 2954009234
378 2954681116
379 2954683041
380 2990061039
381 2990091206
382 2997601893
383 3006323399
384 8002749223
385 8008560368
386 8025478763
387 8047899998
388 8048132918
389 8048358930
390 8048376947
391 8048386000
392 8056448336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02784

Orn_Arg_deC_N

Pyridoxal-dependent decarboxylase, pyridoxal binding domain

23

275

0.85

PF00278

Orn_DAP_Arg_deC

Pyridoxal-dependent decarboxylase, C-terminal sheet domain

18

374

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6knk-assembly1.cif.gz_A crystal structure of sbnh in complex with citryl-diaminoethane 0.92 5 409
6knh-assembly1.cif.gz_B crystal structure of sbnh in complex with citrate, a plp-dependent decarboxylase in staphyloferrin b biothesynthesis 0.9191 5 409
6kni-assembly1.cif.gz_B crystal structure of sbnh in complex with the cofactor plp, a plp-dependent decarboxylase in staphyloferrin b biothesynthesis 0.9167 5 409
6knh-assembly1.cif.gz_B crystal structure of sbnh in complex with citrate, a plp-dependent decarboxylase in staphyloferrin b biothesynthesis 0.9076 5 409
6knk-assembly2.cif.gz_C-2 crystal structure of sbnh in complex with citryl-diaminoethane 0.9071 5 409
ID Description Score Start End Superfamily
af_Q2G1M6_27_256_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9204 30 260 3.20.20.10
af_Q2G1M6_27_256_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9128 30 260 3.20.20.10
af_Q2G1M6_257_399_2.40.37.10 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 0.8954 271 408 2.40.37.10
2qghA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8696 28 270 3.20.20.10
3c5qA01 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 0.8669 271 409 2.40.37.10
ID Description Score Start End GO Terms
AF-A0A2A2YN58-F1-model_v4 deleted 0.9858 1 409
AF-A0A2A2YN58-F1-model_v4 deleted 0.9736 1 409
AF-A0A6B2VWW5-F1-model_v4 Type III PLP-dependent enzyme 0.9659 4 408 GO:0006596
GO:0008836
GO:0009089
AF-A0A5N8WIY1-F1-model_v4 Type III PLP-dependent enzyme 0.9631 1 168 GO:0008836
GO:0009089
AF-A0A5N8WIY1-F1-model_v4 Type III PLP-dependent enzyme 0.9575 1 168 GO:0008836
GO:0009089

Map