F302287

General Info

Members Datasets Scaffolds Average Seq Length
196 160 393 242

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2854916844|2854918148
Length 249
Sequence FDLSGKTAIVTGANTGLGQAIAVALAGAGADVALVGRSSMSETEAAIAAAGDGKSHTIKADLSTIEPVQDVIDQTIAWTGRADILVNNAGIIRRADAIDFSEADWDAVMDVNLKTVFFLSQAFARRLISEGKSGKIINIASLLSFQGGIRIPSYTASKSGLAGLTRLLACEWAGKGINVNAIAPGYFSTNNTEALRNDPDRNSAILGRIPAGHWGQPEELGGAAVFLASPAADYIHGVVLPVDGGWLAR

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
70 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
90 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
146 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
147 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
148 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
151 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
152 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
153 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
154 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
155 2643221559 Lysobacter sp. Root559 Isolate Unclassified
156 2643221586 Lysobacter sp. Root667 Isolate Unclassified
157 2643221612 Lysobacter sp. Root76 Isolate Unclassified
158 2643221727 Lysobacter sp. Root96 Isolate Unclassified
159 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
160 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.39
Metatranscriptomes 0
Isolates 5.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.1
Nodule 1.53
Rhizoplane 5.1
Rhizosphere 82.65
Stem 0
Stem Tuber 0
Unclassified 2.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1004015 3300002987 Bacteria 5008
2 rootH1_10034987 3300003316 Bacteria 2995
3 rootH1_10034987 3300003323 Bacteria 2157
4 rootH1_10133223 3300003323 Bacteria 6370
5 rootH1_10136334 3300003323 Bacteria 2871
6 Ga0055526_1006155 3300003771 Bacteria 6607
7 Ga0070683_100002139 3300005329 Bacteria 15616
8 Ga0070682_100000760 3300005337 Bacteria 19158
9 Ga0070689_100054659 3300005340 Bacteria 3091
10 Ga0070689_100089543 3300005340 Bacteria 2424
11 Ga0070689_100289970 3300005340 Bacteria 1360
12 Ga0070687_100027709 3300005343 Bacteria 2740
13 Ga0070687_100057014 3300005343 Bacteria 2047
14 Ga0070661_100403403 3300005344 Bacteria 1081
15 Ga0070669_100056025 3300005353 Bacteria 2890
16 Ga0070671_100012960 3300005355 Bacteria 6717
17 Ga0070667_100044642 3300005367 Bacteria 3723
18 Ga0070685_10349276 3300005466 Bacteria 1011
19 Ga0070707_100126827 3300005468 Bacteria 2480
20 Ga0070707_100191166 3300005468 Bacteria 1996
21 Ga0070684_100022682 3300005535 Bacteria 5239
22 Ga0070684_100060843 3300005535 Bacteria 3304
23 Ga0070672_100538548 3300005543 Bacteria 1013
24 Ga0070686_100103528 3300005544 Bacteria 1927
25 Ga0070664_100088403 3300005564 Bacteria 2679
26 Ga0068857_100029417 3300005577 Bacteria 4848
27 Ga0068857_100843645 3300005577 Bacteria 876
28 Ga0068856_100743006 3300005614 Bacteria 1001
29 Ga0068859_100462478 3300005617 Bacteria 1364
30 Ga0068870_10174511 3300005840 Bacteria 1285
31 Ga0068863_100091224 3300005841 Bacteria 2889
32 Ga0068858_100319826 3300005842 Bacteria 1483
33 Ga0068858_100506181 3300005842 Bacteria 1167
34 Ga0068860_100129033 3300005843 Bacteria 2425
35 Ga0068860_100419167 3300005843 Bacteria 1327
36 Ga0068862_100104495 3300005844 Bacteria 2481
37 Ga0081455_10016030 3300005937 Bacteria 7250
38 Ga0075368_10014486 3300006042 Bacteria 2914
39 Ga0075367_10007085 3300006178 Bacteria 5716
40 Ga0075366_10054331 3300006195 Bacteria 2379
41 Ga0075428_100031016 3300006844 Bacteria 5911
42 Ga0075434_100574621 3300006871 Bacteria 1146
43 Ga0097620_100462517 3300006931 Bacteria 1364
44 Ga0099795_10064541 3300007788 Bacteria 1367
45 Ga0105240_10492240 3300009093 Unclassified 1365
46 Ga0111539_10215970 3300009094 Bacteria 2234
47 Ga0114129_10013107 3300009147 Bacteria 11807
48 Ga0114129_10041171 3300009147 Bacteria 6512
49 Ga0114129_10398202 3300009147 Bacteria 1815
50 Ga0105248_10037919 3300009177 Bacteria 5392
51 Ga0105248_10640221 3300009177 Bacteria 1200
52 Ga0105248_10772878 3300009177 Bacteria 1084
53 Ga0123341_1073752 3300009765 Bacteria 1438
54 Ga0157369_10181699 3300013105 Bacteria 2213
55 Ga0157378_10117479 3300013297 Bacteria 2447
56 Ga0157372_10172809 3300013307 Unclassified 2500
57 Ga0157375_10110302 3300013308 Bacteria 2849
58 Ga0157375_10367436 3300013308 Bacteria 1605
59 Ga0163163_10000003 3300014325 Bacteria 455102
60 Ga0157376_10461207 3300014969 Bacteria 1241
61 Ga0209564_1000565 3300025295 Bacteria 58712
62 Ga0207710_10125322 3300025900 Bacteria 1230
63 Ga0207680_10130034 3300025903 Bacteria 1658
64 Ga0207643_10125927 3300025908 Bacteria 1521
65 Ga0207707_10261090 3300025912 Bacteria 1503
66 Ga0207662_10118386 3300025918 Bacteria 1659
67 Ga0207662_10175121 3300025918 Bacteria 1378
68 Ga0207649_10176341 3300025920 Bacteria 1493
69 Ga0207646_10261209 3300025922 Bacteria 1565
70 Ga0207681_10043413 3300025923 Bacteria 3009
71 Ga0207670_10103589 3300025936 Bacteria 2037
72 Ga0207704_10351794 3300025938 Bacteria 1147
73 Ga0207704_10394036 3300025938 Bacteria 1091
74 Ga0207711_10034919 3300025941 Bacteria 4259
75 Ga0207661_10002020 3300025944 Bacteria 13988
76 Ga0207661_10004731 3300025944 Bacteria 9534
77 Ga0207679_10057238 3300025945 Bacteria 2883
78 Ga0207651_10105266 3300025960 Bacteria 2104
79 Ga0207651_10376293 3300025960 Bacteria 1202
80 Ga0207658_10232110 3300025986 Bacteria 1558
81 Ga0207703_10025469 3300026035 Bacteria 4653
82 Ga0207703_10445539 3300026035 Bacteria 1209
83 Ga0207708_10066145 3300026075 Bacteria 2764
84 Ga0207702_10613721 3300026078 Bacteria 1068
85 Ga0207641_10004059 3300026088 Bacteria 12769
86 Ga0207674_10374372 3300026116 Bacteria 1376
87 Ga0207675_100230157 3300026118 Bacteria 1788
88 Ga0207428_10109833 3300027907 Bacteria 2124
89 Ga0268264_10074439 3300028381 Bacteria 2885
90 Ga0268264_10222217 3300028381 Bacteria 1739
91 Ga0265319_1002136 3300028563 Bacteria 11064
92 Ga0265319_1013756 3300028563 Bacteria 3200
93 Ga0265320_10020322 3300031240 Bacteria 3602
94 Ga0265327_10097928 3300031251 Bacteria 1420
95 Ga0265316_10002879 3300031344 Bacteria 17609
96 Ga0265316_10069444 3300031344 Bacteria 2719
97 Ga0265314_10000003 3300031711 Bacteria 1653386
98 Ga0265314_10048637 3300031711 Bacteria 2974
99 Ga0265342_10000091 3300031712 Bacteria 99171
100 Ga0316578_10124821 3300031728 Bacteria 1548
101 Ga0307406_10612341 3300031901 Bacteria 899
102 Ga0307412_10496742 3300031911 Bacteria 1015
103 Ga0307415_100295137 3300032126 Bacteria 1340
104 Ga0373923_0145589 3300035111 Bacteria 1073
105 Ga0373939_0028562 3300035114 Bacteria 1589
106 Ga0373953_0049429 3300035117 Bacteria 1697
107 Ga0373954_0014161 3300035118 Bacteria 3556
108 Ga0373954_0094710 3300035118 Bacteria 1437
109 Ga0373956_0160155 3300035119 Bacteria 1060
110 Ga0373957_0013464 3300035120 Bacteria 2776
111 Ga0373955_0006063 3300035172 Bacteria 5486
112 Ga0373933_0184026 3300035724 Bacteria 1333
113 Ga0373933_0252361 3300035724 Bacteria 1136
114 Ga0373937_0006444 3300036401 Bacteria 10129
115 Ga0316582_0060925 3300036647 Unclassified 2420
116 Ga0316584_0337365 3300036712 Bacteria 1084
117 Ga0316581_0056792 3300037588 Unclassified 1200
118 Ga0436360_0777850 3300039438 Bacteria 12828
119 Ga0439465_0057117 3300041413 Bacteria 1287
120 Ga0451577_0397238 3300042876 Bacteria 1251
121 Ga0466969_0030880 3300044656 Bacteria 2728
122 Ga0466968_0024280 3300044735 Bacteria 2475
123 Ga0466968_0040429 3300044735 Bacteria 1966
124 Ga0466957_0319057 3300044842 Bacteria 1048
125 Ga0466959_0159117 3300045049 Bacteria 1588
126 Ga0451576_0237330 3300045051 Bacteria 1904
127 Ga0466967_0699437 3300045976 Bacteria 1004
128 Ga0495592_0010970 3300046454 Bacteria 6837
129 Ga0495603_0056518 3300046455 Bacteria 2323
130 Ga0495629_0044641 3300046459 Bacteria 3110
131 Ga0495651_0109709 3300046462 Bacteria 2042
132 Ga0495594_0068840 3300046499 Bacteria 1966
133 Ga0495618_0102826 3300046514 Bacteria 1829
134 Ga0495628_0068400 3300046516 Bacteria 2772
135 Ga0495628_0089341 3300046516 Bacteria 2386
136 Ga0495630_0017501 3300046517 Bacteria 5252
137 Ga0495652_0026593 3300046529 Bacteria 5108
138 Ga0495640_0002537 3300046533 Bacteria 14673
139 Ga0495640_0270621 3300046533 Bacteria 1060
140 Ga0495586_0014149 3300046535 Bacteria 4239
141 Ga0495621_0255242 3300046539 Bacteria 717
142 Ga0495634_0071984 3300046642 Bacteria 2274
143 Ga0495657_0056454 3300046675 Bacteria 2614
144 Ga0495657_0104237 3300046675 Bacteria 1804
145 Ga0495599_0044714 3300046678 Bacteria 2777
146 Ga0495613_0017880 3300046689 Bacteria 5285
147 Ga0495600_0189444 3300046809 Bacteria 1323
148 Ga0495604_0002737 3300047317 Bacteria 14140
149 Ga0495674_0002762 3300047319 Bacteria 17034
150 Ga0495676_0002734 3300047321 Bacteria 15828
151 Ga0495680_0091106 3300047322 Bacteria 2286
152 Ga0495675_0064277 3300047444 Bacteria 2321
153 Ga0496105_0157518 3300048908 Bacteria 1865
154 Ga0496108_0034510 3300048911 Bacteria 4204
155 Ga0496109_0059371 3300048912 Bacteria 3494
156 Ga0496110_0354275 3300048913 Bacteria 1337
157 Ga0496110_0517055 3300048913 Bacteria 1086
158 Ga0496112_0061580 3300048915 Bacteria 3700
159 Ga0496112_0666857 3300048915 Bacteria 969
160 Ga0496114_0006889 3300048917 Bacteria 8951
161 Ga0496114_0010906 3300048917 Bacteria 7241
162 Ga0496115_0238225 3300048918 Bacteria 1500
163 Ga0496126_0089034 3300048929 Bacteria 2718
164 Ga0501033_0570070 3300049570 Bacteria 778
165 Ga0501041_0049198 3300049577 Bacteria 2568
166 Ga0501042_0120950 3300049578 Bacteria 1885
167 Ga0501069_0060659 3300049585 Bacteria 2112
168 Ga0501071_0035920 3300049587 Bacteria 3532
169 Ga0501075_0043446 3300049591 Bacteria 3371
170 Ga0501080_0341080 3300049742 Bacteria 1354
171 Ga0501081_0064220 3300049743 Bacteria 2549
172 Ga0501045_0282136 3300049824 Bacteria 1237
173 nmdc:mga05p37_31408_c1 3300050507 Bacteria 6486
174 nmdc:mga05p37_70526_c1 3300050507 Bacteria 4298
175 nmdc:mga05p37_73924_c1 3300050507 Bacteria 4195
176 nmdc:mga08y16_149995_c1 3300050511 Bacteria 2424
177 nmdc:mga08y16_341511_c1 3300050511 Bacteria 1539
178 nmdc:mga0n895_204848_c1 3300050512 Bacteria 2003
179 nmdc:mga0a205_223725_c1 3300050515 Bacteria 1767
180 Ga0495601_0060344 3300053077 Bacteria 2407
181 Ga0495619_0156696 3300053085 Bacteria 1572
182 Ga0500643_042453 3300053087 Bacteria 1331
183 Ga0500555_000117 3300053103 Bacteria 37913
184 Ga0500595_000817 3300053119 Bacteria 17937
185 Ga0500645_000345 3300053730 Bacteria 33099
186 Ga0501084_0081405 3300054114 Bacteria 2716
187 2854918148 2854916844 Bacteria 5725939
188 2513595903 2513237088 Bacteria 6927906
189 2513869865 2513237138 Bacteria 7368160
190 2585402921 2582581867 Bacteria 7184437
191 2585820103 2585427590 Bacteria 6824633
192 2643815989 2643221559 Bacteria 4424915
193 2643939538 2643221586 Bacteria 4446529
194 2644078213 2643221612 Bacteria 4361984
195 2644696516 2643221727 Bacteria 4415595
196 2854900956 2854896431 Bacteria 5869725
197 2923560962 2923556063 Bacteria 6793593
198 JGI25159J45721_1004015
199 rootH1_10034987
200 rootH1_10133223
201 rootH1_10136334
202 Ga0055526_1006155
203 Ga0070683_100002139
204 Ga0070682_100000760
205 Ga0070689_100054659
206 Ga0070689_100089543
207 Ga0070689_100289970
208 Ga0070687_100027709
209 Ga0070687_100057014
210 Ga0070661_100403403
211 Ga0070669_100056025
212 Ga0070671_100012960
213 Ga0070667_100044642
214 Ga0070685_10349276
215 Ga0070707_100126827
216 Ga0070707_100191166
217 Ga0070684_100022682
218 Ga0070684_100060843
219 Ga0070672_100538548
220 Ga0070686_100103528
221 Ga0070664_100088403
222 Ga0068857_100029417
223 Ga0068857_100843645
224 Ga0068856_100743006
225 Ga0068859_100462478
226 Ga0068870_10174511
227 Ga0068863_100091224
228 Ga0068858_100319826
229 Ga0068858_100506181
230 Ga0068860_100129033
231 Ga0068860_100419167
232 Ga0068862_100104495
233 Ga0081455_10016030
234 Ga0075368_10014486
235 Ga0075367_10007085
236 Ga0075366_10054331
237 Ga0075428_100031016
238 Ga0075434_100574621
239 Ga0097620_100462517
240 Ga0099795_10064541
241 Ga0105240_10492240
242 Ga0111539_10215970
243 Ga0114129_10013107
244 Ga0114129_10041171
245 Ga0114129_10398202
246 Ga0105248_10037919
247 Ga0105248_10640221
248 Ga0105248_10772878
249 Ga0123341_1073752
250 Ga0157369_10181699
251 Ga0157378_10117479
252 Ga0157372_10172809
253 Ga0157375_10110302
254 Ga0157375_10367436
255 Ga0163163_10000003
256 Ga0157376_10461207
257 Ga0209564_1000565
258 Ga0207710_10125322
259 Ga0207680_10130034
260 Ga0207643_10125927
261 Ga0207707_10261090
262 Ga0207662_10118386
263 Ga0207662_10175121
264 Ga0207649_10176341
265 Ga0207646_10261209
266 Ga0207681_10043413
267 Ga0207670_10103589
268 Ga0207704_10351794
269 Ga0207704_10394036
270 Ga0207711_10034919
271 Ga0207661_10002020
272 Ga0207661_10004731
273 Ga0207679_10057238
274 Ga0207651_10105266
275 Ga0207651_10376293
276 Ga0207658_10232110
277 Ga0207703_10025469
278 Ga0207703_10445539
279 Ga0207708_10066145
280 Ga0207702_10613721
281 Ga0207641_10004059
282 Ga0207674_10374372
283 Ga0207675_100230157
284 Ga0207428_10109833
285 Ga0268264_10074439
286 Ga0268264_10222217
287 Ga0265319_1002136
288 Ga0265319_1013756
289 Ga0265320_10020322
290 Ga0265327_10097928
291 Ga0265316_10002879
292 Ga0265316_10069444
293 Ga0265314_10000003
294 Ga0265314_10048637
295 Ga0265342_10000091
296 Ga0316578_10124821
297 Ga0307406_10612341
298 Ga0307412_10496742
299 Ga0307415_100295137
300 Ga0373923_0145589
301 Ga0373939_0028562
302 Ga0373953_0049429
303 Ga0373954_0014161
304 Ga0373954_0094710
305 Ga0373956_0160155
306 Ga0373957_0013464
307 Ga0373955_0006063
308 Ga0373933_0184026
309 Ga0373933_0252361
310 Ga0373937_0006444
311 Ga0316582_0060925
312 Ga0316584_0337365
313 Ga0316581_0056792
314 Ga0436360_0777850
315 Ga0439465_0057117
316 Ga0451577_0397238
317 Ga0466969_0030880
318 Ga0466968_0024280
319 Ga0466968_0040429
320 Ga0466957_0319057
321 Ga0466959_0159117
322 Ga0451576_0237330
323 Ga0466967_0699437
324 Ga0495592_0010970
325 Ga0495603_0056518
326 Ga0495629_0044641
327 Ga0495651_0109709
328 Ga0495594_0068840
329 Ga0495618_0102826
330 Ga0495628_0068400
331 Ga0495628_0089341
332 Ga0495630_0017501
333 Ga0495652_0026593
334 Ga0495640_0002537
335 Ga0495640_0270621
336 Ga0495586_0014149
337 Ga0495621_0255242
338 Ga0495634_0071984
339 Ga0495657_0056454
340 Ga0495657_0104237
341 Ga0495599_0044714
342 Ga0495613_0017880
343 Ga0495600_0189444
344 Ga0495604_0002737
345 Ga0495674_0002762
346 Ga0495676_0002734
347 Ga0495680_0091106
348 Ga0495675_0064277
349 Ga0496105_0157518
350 Ga0496108_0034510
351 Ga0496109_0059371
352 Ga0496110_0354275
353 Ga0496110_0517055
354 Ga0496112_0061580
355 Ga0496112_0666857
356 Ga0496114_0006889
357 Ga0496114_0010906
358 Ga0496115_0238225
359 Ga0496126_0089034
360 Ga0501033_0570070
361 Ga0501041_0049198
362 Ga0501042_0120950
363 Ga0501069_0060659
364 Ga0501071_0035920
365 Ga0501075_0043446
366 Ga0501080_0341080
367 Ga0501081_0064220
368 Ga0501045_0282136
369 nmdc:mga05p37_31408_c1
370 nmdc:mga05p37_70526_c1
371 nmdc:mga05p37_73924_c1
372 nmdc:mga08y16_149995_c1
373 nmdc:mga08y16_341511_c1
374 nmdc:mga0n895_204848_c1
375 nmdc:mga0a205_223725_c1
376 Ga0495601_0060344
377 Ga0495619_0156696
378 Ga0500643_042453
379 Ga0500555_000117
380 Ga0500595_000817
381 Ga0500645_000345
382 Ga0501084_0081405
383 2854918148
384 2513595903
385 2513869865
386 2585402921
387 2585820103
388 2643815989
389 2643939538
390 2644078213
391 2644696516
392 2854900956
393 2923560962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

6

200

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

12

247

0.95

PF08659

KR

KR domain

6

188

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z9y-assembly1.cif.gz_B crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from pectobacterium carotovorum 0.9646 4 234
4z9y-assembly1.cif.gz_B crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from pectobacterium carotovorum 0.9484 4 234
4j2h-assembly1.cif.gz_A crystal structure of a putative short-chain alcohol dehydrogenase from sinorhizobium meliloti 1021 (target nysgrc-011708) 0.9481 4 234
1vl8-assembly1.cif.gz_B crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution 0.9477 5 234
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9448 7 231
ID Description Score Start End Superfamily
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9621 4 234 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9539 68 231 3.40.50.720
1vl8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9477 5 234 3.40.50.720
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.946 4 234 3.40.50.720
1iy8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9398 9 234 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3B9GII0-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9899 88 234 GO:0016616
AF-A0A496SLJ1-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9866 68 234 GO:0016616
AF-A0A848WJQ7-F1-model_v4 SDR family oxidoreductase 0.9856 75 234 GO:0016616
AF-A0A147IJ21-F1-model_v4 3-ketoacyl-ACP reductase 0.9853 60 234 GO:0016616
AF-A0A826R264-F1-model_v4 deleted 0.9851 65 234

Map