F302260

General Info

Members Datasets Scaffolds Average Seq Length
196 140 160 418

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2582581278|2585143468
Length 443
Sequence KLNNLKTLNGSKKGLKNSTMKIYRYPTKDTWKDLVKRPVLEQKEISGLITEIFIEVEKKGDEALIEFNKKFDKAETRSIKVSDAEIQEAENQIQDELKQAIQQAKENISIFHASQKQEIQKIETTKGVVCWRENRAVESVGIYIPGGTAPLFSTVLMLAVPANLAGCKEIILCTPPDKNGNVNPAILYAAKLCGVSKIFKTGGAQAVAAMTFGTESIPSVNKIFGPGNQFVVAAKEYAQRYGVAIDMPAGPSEVLVIADEKAVPDFCAADLLSQAEHGSDSQVVFITTDFKVFEETIKAVGQQVRDLPRNEFAGQALENSSFILVDSLEEALEFSNLYAPEHLILAIDNFEKYIPEVQNAGSVFLGNYSCESAGDYASGTNHTLPTNAYAKNYSGVSLDSFVKKITFQHLSKEGLQNLGKTIELMAEAEGLFAHKNAVSIRLK

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
4 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
5 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
6 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
7 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
8 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
9 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
10 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
11 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
12 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
13 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
14 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
15 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
16 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
17 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
18 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
19 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
20 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
21 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
22 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
23 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
24 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
25 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
26 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
27 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
28 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
29 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
30 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
31 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
32 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
33 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
34 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
35 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
36 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.63
Metatranscriptomes 0
Isolates 18.37

Biome Distribution

Category Percentage (%)
Aerial Root 1.02
Bulb 0
Endosphere 1.53
Nodule 0.51
Rhizoplane 3.06
Rhizosphere 79.59
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10259182 3300003322 Bacteria 4865
2 rootL2_10286064 3300003322 Bacteria 2405
3 rootH1_10035284 3300003323 Bacteria 47456
4 Ga0065714_10064750 3300005288 Bacteria 20200
5 Ga0065704_10083999 3300005289 Bacteria 3388
6 Ga0065704_10086470 3300005289 Bacteria 3116
7 Ga0065704_10104178 3300005289 Bacteria 2149
8 Ga0070658_10011471 3300005327 Bacteria 7106
9 Ga0070670_100038708 3300005331 Bacteria 4100
10 Ga0070689_100070686 3300005340 Bacteria 2725
11 Ga0070675_100240499 3300005354 Bacteria 1582
12 Ga0070688_100167759 3300005365 Bacteria 1513
13 Ga0070685_10100032 3300005466 Bacteria 1770
14 Ga0070679_100007656 3300005530 Bacteria 10111
15 Ga0068853_100016539 3300005539 Bacteria 6074
16 Ga0068853_100116334 3300005539 Bacteria 2380
17 Ga0070664_100014454 3300005564 Bacteria 6435
18 Ga0068857_100135658 3300005577 Bacteria 2222
19 Ga0068856_100007967 3300005614 Bacteria 10348
20 Ga0068859_100014329 3300005617 Bacteria 7953
21 Ga0068863_100015360 3300005841 Bacteria 7359
22 Ga0068860_100011274 3300005843 Bacteria 8808
23 Ga0068860_100011999 3300005843 Bacteria 8534
24 Ga0068862_100010385 3300005844 Bacteria 7684
25 Ga0068862_100025020 3300005844 Bacteria 5011
26 Ga0068862_100032995 3300005844 Bacteria 4374
27 Ga0068862_100141254 3300005844 Bacteria 2137
28 Ga0068871_100069523 3300006358 Bacteria 2892
29 Ga0068865_100057864 3300006881 Unclassified 2706
30 Ga0097620_100014329 3300006931 Bacteria 7953
31 Ga0105247_10010386 3300009101 Bacteria 5633
32 Ga0105247_10012510 3300009101 Bacteria 5098
33 Ga0105243_10002194 3300009148 Bacteria 16455
34 Ga0105242_10034951 3300009176 Bacteria 4030
35 Ga0105242_10180598 3300009176 Bacteria 1861
36 Ga0105248_10424004 3300009177 Bacteria 1498
37 Ga0105249_10086328 3300009553 Bacteria 2926
38 Ga0105249_10183811 3300009553 Bacteria 2036
39 Ga0105249_10397832 3300009553 Bacteria 1407
40 Ga0157373_10000036 3300013100 Bacteria 122723
41 Ga0157371_10040872 3300013102 Unclassified 3310
42 Ga0157370_10029883 3300013104 Bacteria 5342
43 Ga0157369_10060902 3300013105 Bacteria 4070
44 Ga0163162_10013133 3300013306 Bacteria 8087
45 Ga0157375_10000910 3300013308 Bacteria 25705
46 Ga0157375_10033652 3300013308 Bacteria 4873
47 Ga0163163_10048819 3300014325 Bacteria 4163
48 Ga0157380_10019234 3300014326 Bacteria 5088
49 Ga0182008_10000011 3300014497 Bacteria 297770
50 Ga0182006_1000011 3300015261 Bacteria 408647
51 Ga0163161_10020644 3300017792 Bacteria 4625
52 Ga0163161_10028968 3300017792 Bacteria 3935
53 Ga0207710_10002439 3300025900 Bacteria 8644
54 Ga0207705_10020747 3300025909 Bacteria 4689
55 Ga0207707_10019047 3300025912 Bacteria 5989
56 Ga0207671_10098842 3300025914 Bacteria 2208
57 Ga0207650_10175091 3300025925 Bacteria 1707
58 Ga0207706_10110622 3300025933 Bacteria 2417
59 Ga0207686_10028042 3300025934 Unclassified 3305
60 Ga0207711_10007653 3300025941 Bacteria 9036
61 Ga0207712_10005109 3300025961 Bacteria 8305
62 Ga0207677_10128546 3300026023 Bacteria 1919
63 Ga0207702_10005976 3300026078 Bacteria 10568
64 Ga0207641_10008776 3300026088 Bacteria 8347
65 Ga0207648_10049586 3300026089 Bacteria 3673
66 Ga0207674_10066764 3300026116 Bacteria 3622
67 Ga0268265_10068604 3300028380 Bacteria 2750
68 Ga0268265_10179643 3300028380 Bacteria 1817
69 Ga0268264_10003107 3300028381 Bacteria 14381
70 Ga0268264_10138927 3300028381 Bacteria 2164
71 Ga0265332_10017516 3300031238 Bacteria 3161
72 Ga0265327_10000972 3300031251 Bacteria 40973
73 Ga0265316_10002342 3300031344 Bacteria 19745
74 Ga0265342_10000007 3300031712 Bacteria 228257
75 Ga0307405_10014862 3300031731 Bacteria 4200
76 Ga0307405_10050840 3300031731 Bacteria 2569
77 Ga0307413_10083712 3300031824 Bacteria 2053
78 Ga0307410_10001320 3300031852 Bacteria 11079
79 Ga0307410_10003161 3300031852 Bacteria 8191
80 Ga0307406_10008639 3300031901 Bacteria 5692
81 Ga0307406_10038538 3300031901 Bacteria 2959
82 Ga0307407_10004137 3300031903 Bacteria 6111
83 Ga0307407_10011863 3300031903 Bacteria 4167
84 Ga0307412_10000012 3300031911 Bacteria 404180
85 Ga0307412_10004438 3300031911 Bacteria 7817
86 Ga0307412_10012634 3300031911 Bacteria 4928
87 Ga0307409_100001249 3300031995 Bacteria 12255
88 Ga0307409_100144012 3300031995 Bacteria 2058
89 Ga0307416_100000010 3300032002 Bacteria 320243
90 Ga0307416_100044187 3300032002 Bacteria 3496
91 Ga0307416_100063286 3300032002 Archaea 3029
92 Ga0307414_10000009 3300032004 Bacteria 359782
93 Ga0307414_10003230 3300032004 Bacteria 8679
94 Ga0307414_10012409 3300032004 Bacteria 5037
95 Ga0307414_10081015 3300032004 Bacteria 2375
96 Ga0307411_10002924 3300032005 Bacteria 7745
97 Ga0307411_10200819 3300032005 Bacteria 1531
98 Ga0307415_100059949 3300032126 Bacteria 2627
99 Ga0307415_100134163 3300032126 Archaea 1880
100 Ga0307415_100161547 3300032126 Bacteria 1737
101 Ga0451791_0681083 3300041451 Bacteria 1832
102 Ga0451577_0044414 3300042876 Bacteria 3979
103 Ga0451577_0101103 3300042876 Bacteria 2576
104 Ga0453683_0020539 3300044673 Bacteria 4219
105 Ga0453684_0000557 3300044712 Bacteria 140566
106 Ga0453684_0001834 3300044712 Bacteria 55525
107 Ga0453684_0004470 3300044712 Bacteria 29452
108 Ga0453684_0009766 3300044712 Bacteria 16663
109 Ga0453684_0034212 3300044712 Bacteria 7060
110 Ga0453684_0068852 3300044712 Bacteria 4491
111 Ga0453684_0071008 3300044712 Bacteria 4405
112 Ga0453684_0106561 3300044712 Bacteria 3415
113 Ga0453684_0137881 3300044712 Bacteria 2918
114 Ga0453684_0269667 3300044712 Bacteria 1946
115 Ga0451576_0007064 3300045051 Bacteria 13567
116 Ga0495627_000003 3300046453 Bacteria 704557
117 Ga0495638_0127220 3300046460 Bacteria 1501
118 Ga0495606_0019868 3300046507 Bacteria 4975
119 Ga0495610_0000001 3300046512 Bacteria 1620061
120 Ga0495632_0008157 3300046519 Bacteria 6472
121 Ga0495643_0002373 3300046522 Bacteria 15070
122 Ga0495663_0000151 3300046525 Bacteria 28138
123 Ga0495654_0000001 3300046530 Bacteria 1513197
124 Ga0495609_0000134 3300046538 Bacteria 79757
125 Ga0495633_0000008 3300046558 Bacteria 301830
126 Ga0495633_0004351 3300046558 Bacteria 9044
127 Ga0495668_0000292 3300046616 Bacteria 68757
128 Ga0495668_0000592 3300046616 Bacteria 44008
129 Ga0495668_0000751 3300046616 Bacteria 38311
130 Ga0495625_0000781 3300046660 Bacteria 44239
131 Ga0495625_0046734 3300046660 Bacteria 3122
132 Ga0495686_0000118 3300047472 Bacteria 165897
133 Ga0495686_0000884 3300047472 Bacteria 38050
134 Ga0495686_0028549 3300047472 Bacteria 3633
135 Ga0496102_0031353 3300048905 Bacteria 4768
136 Ga0496104_0332711 3300048907 Bacteria 1432
137 Ga0496109_0195580 3300048912 Unclassified 1901
138 Ga0496115_0007421 3300048918 Bacteria 8067
139 Ga0496115_0053220 3300048918 Bacteria 3248
140 Ga0496116_0000053 3300048919 Bacteria 291837
141 Ga0496117_0000050 3300048920 Bacteria 292727
142 Ga0496118_0000044 3300048921 Bacteria 283524
143 Ga0496119_0000002 3300048922 Bacteria 738385
144 Ga0496121_0035012 3300048924 Bacteria 4507
145 Ga0496122_0000188 3300048925 Bacteria 143808
146 Ga0496122_0000191 3300048925 Bacteria 140173
147 Ga0496122_0000538 3300048925 Bacteria 78492
148 Ga0496122_0000769 3300048925 Bacteria 61918
149 Ga0496122_0037488 3300048925 Bacteria 3901
150 Ga0496123_0000636 3300048926 Bacteria 58636
151 Ga0496123_0003634 3300048926 Bacteria 17066
152 Ga0496123_0005816 3300048926 Bacteria 12234
153 Ga0496124_0001056 3300048927 Bacteria 43505
154 Ga0496125_0000310 3300048928 Bacteria 95700
155 Ga0496125_0007782 3300048928 Bacteria 11336
156 Ga0496125_0008192 3300048928 Bacteria 10999
157 Ga0496126_0000660 3300048929 Bacteria 63892
158 Ga0500556_0021008 3300053104 Bacteria 2098
159 Ga0500616_0000849 3300053153 Bacteria 34031
160 Ga0500627_0004661 3300053158 Bacteria 4438

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0000769 Ga0496122_0000769_50676_51950 321
2 3300048926 Ga0496123_0005816 Ga0496123_0005816_5490_6764 321
3 3300048929 Ga0496126_0000660 Ga0496126_0000660_4276_5550 361
4 3300046525 Ga0495663_0000151 Ga0495663_0000151_1720_2994 369
5 3300048905 Ga0496102_0031353 Ga0496102_0031353_3370_4674 372
6 3300048919 Ga0496116_0000053 Ga0496116_0000053_160686_161990 372
7 3300048920 Ga0496117_0000050 Ga0496117_0000050_278649_279953 372
8 3300048921 Ga0496118_0000044 Ga0496118_0000044_12802_14106 372
9 3300048922 Ga0496119_0000002 Ga0496119_0000002_14980_16284 372
10 3300048925 Ga0496122_0000191 Ga0496122_0000191_13108_14412 372
11 3300048926 Ga0496123_0000636 Ga0496123_0000636_12794_14098 372
12 3300048927 Ga0496124_0001056 Ga0496124_0001056_10413_11717 372
13 3300048928 Ga0496125_0007782 Ga0496125_0007782_7134_8438 372
14 3300003323 rootH1_10035284 rootH1_1003528413 373
15 3300013100 Ga0157373_10000036 Ga0157373_10000036108 376
16 3300013105 Ga0157369_10060902 Ga0157369_100609022 376
17 3300046558 Ga0495633_0004351 Ga0495633_0004351_4446_5741 376
18 3300046660 Ga0495625_0000781 Ga0495625_0000781_33331_34626 376
19 3300048928 Ga0496125_0008192 Ga0496125_0008192_3643_4929 376
20 3300003322 rootL2_10286064 rootL2_102860642 377
21 3300046530 Ga0495654_0000001 Ga0495654_0000001_738580_739872 377
22 3300046538 Ga0495609_0000134 Ga0495609_0000134_71756_73030 381
23 3300047472 Ga0495686_0000884 Ga0495686_0000884_16107_17396 381
24 3300014497 Ga0182008_10000011 Ga0182008_1000001112 382
25 3300032004 Ga0307414_10000009 Ga0307414_10000009165 383
26 3300009553 Ga0105249_10183811 Ga0105249_101838112 384
27 3300013308 Ga0157375_10000910 Ga0157375_1000091018 385
28 3300046507 Ga0495606_0019868 Ga0495606_0019868_417_1691 386
29 3300048925 Ga0496122_0000538 Ga0496122_0000538_14578_15855 388
30 3300031238 Ga0265332_10017516 Ga0265332_100175162 389
31 3300031344 Ga0265316_10002342 Ga0265316_100023429 389
32 3300031712 Ga0265342_10000007 Ga0265342_10000007100 389
33 3300044712 Ga0453684_0269667 Ga0453684_0269667_32_1225 392
34 3300032126 Ga0307415_100161547 Ga0307415_1001615472 396
35 3300047472 Ga0495686_0000118 Ga0495686_0000118_129484_130767 403
36 3300048924 Ga0496121_0035012 Ga0496121_0035012_2056_3330 403
37 3300042876 Ga0451577_0101103 Ga0451577_0101103_214_1503 404
38 3300044673 Ga0453683_0020539 Ga0453683_0020539_882_2171 404
39 3300044712 Ga0453684_0000557 Ga0453684_0000557_120867_122156 404
40 3300048907 Ga0496104_0332711 Ga0496104_0332711_179_1408 405
41 3300031911 Ga0307412_10000012 Ga0307412_10000012197 407
42 3300032004 Ga0307414_10081015 Ga0307414_100810152 407
43 3300053104 Ga0500556_0021008 Ga0500556_0021008_628_1917 407
44 3300032002 Ga0307416_100000010 Ga0307416_100000010169 408
45 3300053158 Ga0500627_0004661 Ga0500627_0004661_547_1836 409
46 3300046616 Ga0495668_0000592 Ga0495668_0000592_21199_22488 411
47 3300046453 Ga0495627_000003 Ga0495627_000003_380222_381514 413
48 3300046460 Ga0495638_0127220 Ga0495638_0127220_68_1342 413
49 3300047472 Ga0495686_0028549 Ga0495686_0028549_17_1309 413
50 3300053153 Ga0500616_0000849 Ga0500616_0000849_5680_6969 414
51 3300005530 Ga0070679_100007656 Ga0070679_1000076563 415
52 3300025912 Ga0207707_10019047 Ga0207707_100190472 415
53 3300044712 Ga0453684_0009766 Ga0453684_0009766_1548_2822 415
54 3300045051 Ga0451576_0007064 Ga0451576_0007064_12116_13390 415
55 3300005539 Ga0068853_100116334 Ga0068853_1001163342 416
56 3300025914 Ga0207671_10098842 Ga0207671_100988422 416
57 iso_pu_bacteria 2585428095 2587866775 420
58 iso_pu_bacteria 2585428183 2588213189 420
59 iso_pu_bacteria 2585428184 2588219805 420
60 iso_pu_bacteria 2585428185 2588223922 420
61 iso_pu_bacteria 2728369107 2729198584 420
62 iso_pu_bacteria 2765235839 2765572571 420
63 iso_pu_bacteria 2816332188 2816872922 420
64 iso_pu_bacteria 2842083920 2842084179 420
65 iso_pu_bacteria 2871720351 2871723724 420
66 iso_pu_bacteria 2889290771 2889291701 420
67 iso_pu_bacteria 2905999023 2906000814 420
68 iso_pu_bacteria 2919399522 2919402893 420
69 iso_pu_bacteria 2945924605 2945927286 420
70 iso_pu_bacteria 2511231000 2511234751 421
71 iso_pu_bacteria 2582581281 2585158509 421
72 iso_pu_bacteria 2582581282 2585162853 421
73 iso_pu_bacteria 2582581873 2585424756 421
74 iso_pu_bacteria 2585428045 2587680657 421
75 iso_pu_bacteria 2585428060 2587747863 421
76 iso_pu_bacteria 2585428115 2587942918 421
77 iso_pu_bacteria 2585428182 2588208245 421
78 iso_pu_bacteria 2585428187 2588233481 421
79 iso_pu_bacteria 2588253712 2588446445 421
80 iso_pu_bacteria 2588254255 2590600847 421
81 iso_pu_bacteria 2588254257 2590611892 421
82 iso_pu_bacteria 2738543014 2739254425 421
83 iso_pu_bacteria 2739367874 2740057597 421
84 iso_pu_bacteria 2751185877 2753672697 421
85 iso_pu_bacteria 2946019816 2946021399 421
86 iso_pu_bacteria 2977243572 2977246216 421
87 iso_pu_bacteria 2984572630 2984575973 421
88 iso_pu_bacteria 2984606641 2984609428 421
89 iso_pu_bacteria 2993372514 2993373503 421
90 iso_pu_bacteria 2993480792 2993484186 421
91 iso_pu_bacteria 2958512119 2958513292 422
92 3300009177 Ga0105248_10424004 Ga0105248_104240042 423
93 3300048912 Ga0496109_0195580 Ga0496109_0195580_317_1606 423
94 3300005843 Ga0068860_100011274 Ga0068860_1000112749 424
95 3300005844 Ga0068862_100025020 Ga0068862_1000250205 424
96 3300006881 Ga0068865_100057864 Ga0068865_1000578642 424
97 3300009101 Ga0105247_10010386 Ga0105247_100103862 424
98 3300009101 Ga0105247_10012510 Ga0105247_100125102 424
99 3300009176 Ga0105242_10034951 Ga0105242_100349514 424
100 3300009553 Ga0105249_10086328 Ga0105249_100863283 424
101 3300009553 Ga0105249_10397832 Ga0105249_103978321 424
102 3300013102 Ga0157371_10040872 Ga0157371_100408724 424
103 3300013104 Ga0157370_10029883 Ga0157370_100298832 424
104 3300014325 Ga0163163_10048819 Ga0163163_100488193 424
105 3300015261 Ga0182006_1000011 Ga0182006_1000011242 424
106 3300025900 Ga0207710_10002439 Ga0207710_100024392 424
107 3300025934 Ga0207686_10028042 Ga0207686_100280422 424
108 3300025941 Ga0207711_10007653 Ga0207711_100076533 424
109 3300025961 Ga0207712_10005109 Ga0207712_100051098 424
110 3300026023 Ga0207677_10128546 Ga0207677_101285462 424
111 3300026088 Ga0207641_10008776 Ga0207641_100087763 424
112 3300028380 Ga0268265_10068604 Ga0268265_100686041 424
113 3300028381 Ga0268264_10003107 Ga0268264_100031072 424
114 3300028381 Ga0268264_10138927 Ga0268264_101389272 424
115 3300046512 Ga0495610_0000001 Ga0495610_0000001_1447160_1448434 424
116 3300046558 Ga0495633_0000008 Ga0495633_0000008_169513_170787 424
117 3300046616 Ga0495668_0000751 Ga0495668_0000751_34624_35898 424
118 3300048925 Ga0496122_0037488 Ga0496122_0037488_1616_2890 424
119 iso_pu_bacteria 2582581278 2585143468 424
120 3300003322 rootL2_10259182 rootL2_102591823 425
121 3300005288 Ga0065714_10064750 Ga0065714_100647503 425
122 3300005289 Ga0065704_10083999 Ga0065704_100839993 425
123 3300005289 Ga0065704_10086470 Ga0065704_100864703 425
124 3300005289 Ga0065704_10104178 Ga0065704_101041782 425
125 3300005327 Ga0070658_10011471 Ga0070658_100114712 425
126 3300005331 Ga0070670_100038708 Ga0070670_1000387083 425
127 3300005340 Ga0070689_100070686 Ga0070689_1000706863 425
128 3300005354 Ga0070675_100240499 Ga0070675_1002404992 425
129 3300005365 Ga0070688_100167759 Ga0070688_1001677591 425
130 3300005466 Ga0070685_10100032 Ga0070685_101000322 425
131 3300005539 Ga0068853_100016539 Ga0068853_1000165396 425
132 3300005564 Ga0070664_100014454 Ga0070664_1000144544 425
133 3300005577 Ga0068857_100135658 Ga0068857_1001356582 425
134 3300005614 Ga0068856_100007967 Ga0068856_10000796712 425
135 3300005617 Ga0068859_100014329 Ga0068859_1000143293 425
136 3300005841 Ga0068863_100015360 Ga0068863_1000153608 425
137 3300005843 Ga0068860_100011999 Ga0068860_1000119996 425
138 3300005844 Ga0068862_100010385 Ga0068862_1000103856 425
139 3300005844 Ga0068862_100032995 Ga0068862_1000329952 425
140 3300005844 Ga0068862_100141254 Ga0068862_1001412542 425
141 3300006358 Ga0068871_100069523 Ga0068871_1000695232 425
142 3300006931 Ga0097620_100014329 Ga0097620_1000143295 425
143 3300009148 Ga0105243_10002194 Ga0105243_1000219413 425
144 3300009176 Ga0105242_10180598 Ga0105242_101805982 425
145 3300013306 Ga0163162_10013133 Ga0163162_100131334 425
146 3300013308 Ga0157375_10033652 Ga0157375_100336522 425
147 3300014326 Ga0157380_10019234 Ga0157380_100192344 425
148 3300017792 Ga0163161_10020644 Ga0163161_100206444 425
149 3300017792 Ga0163161_10028968 Ga0163161_100289683 425
150 3300025909 Ga0207705_10020747 Ga0207705_100207472 425
151 3300025925 Ga0207650_10175091 Ga0207650_101750912 425
152 3300025933 Ga0207706_10110622 Ga0207706_101106222 425
153 3300026078 Ga0207702_10005976 Ga0207702_1000597613 425
154 3300026089 Ga0207648_10049586 Ga0207648_100495863 425
155 3300026116 Ga0207674_10066764 Ga0207674_100667643 425
156 3300028380 Ga0268265_10179643 Ga0268265_101796432 425
157 3300031251 Ga0265327_10000972 Ga0265327_1000097219 425
158 3300031731 Ga0307405_10014862 Ga0307405_100148624 425
159 3300031731 Ga0307405_10050840 Ga0307405_100508402 425
160 3300031824 Ga0307413_10083712 Ga0307413_100837122 425
161 3300031852 Ga0307410_10001320 Ga0307410_100013204 425
162 3300031852 Ga0307410_10003161 Ga0307410_100031619 425
163 3300031901 Ga0307406_10008639 Ga0307406_100086396 425
164 3300031901 Ga0307406_10038538 Ga0307406_100385382 425
165 3300031903 Ga0307407_10004137 Ga0307407_100041374 425
166 3300031903 Ga0307407_10011863 Ga0307407_100118632 425
167 3300031911 Ga0307412_10004438 Ga0307412_100044389 425
168 3300031911 Ga0307412_10012634 Ga0307412_100126342 425
169 3300031995 Ga0307409_100001249 Ga0307409_10000124911 425
170 3300031995 Ga0307409_100144012 Ga0307409_1001440122 425
171 3300032002 Ga0307416_100044187 Ga0307416_1000441873 425
172 3300032002 Ga0307416_100063286 Ga0307416_1000632862 425
173 3300032004 Ga0307414_10003230 Ga0307414_100032309 425
174 3300032004 Ga0307414_10012409 Ga0307414_100124095 425
175 3300032005 Ga0307411_10002924 Ga0307411_100029249 425
176 3300032005 Ga0307411_10200819 Ga0307411_102008192 425
177 3300032126 Ga0307415_100059949 Ga0307415_1000599492 425
178 3300032126 Ga0307415_100134163 Ga0307415_1001341632 425
179 3300041451 Ga0451791_0681083 Ga0451791_0681083_435_1742 425
180 3300042876 Ga0451577_0044414 Ga0451577_0044414_2020_3309 425
181 3300044712 Ga0453684_0001834 Ga0453684_0001834_13814_15094 425
182 3300044712 Ga0453684_0004470 Ga0453684_0004470_7861_9156 425
183 3300044712 Ga0453684_0034212 Ga0453684_0034212_3727_5016 425
184 3300044712 Ga0453684_0068852 Ga0453684_0068852_2300_3589 425
185 3300044712 Ga0453684_0071008 Ga0453684_0071008_2304_3593 425
186 3300044712 Ga0453684_0106561 Ga0453684_0106561_410_1690 425
187 3300044712 Ga0453684_0137881 Ga0453684_0137881_690_1979 425
188 3300046519 Ga0495632_0008157 Ga0495632_0008157_1380_2675 425
189 3300046522 Ga0495643_0002373 Ga0495643_0002373_12492_13784 425
190 3300046616 Ga0495668_0000292 Ga0495668_0000292_20584_21882 425
191 3300046660 Ga0495625_0046734 Ga0495625_0046734_1682_2974 425
192 3300048918 Ga0496115_0007421 Ga0496115_0007421_981_2270 425
193 3300048918 Ga0496115_0053220 Ga0496115_0053220_1489_2781 425
194 3300048925 Ga0496122_0000188 Ga0496122_0000188_22016_23293 425
195 3300048926 Ga0496123_0003634 Ga0496123_0003634_10502_11779 425
196 3300048928 Ga0496125_0000310 Ga0496125_0000310_26502_27794 425

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00815

Histidinol_dh

Histidinol dehydrogenase

35

442

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6an0-assembly1.cif.gz_A-2 crystal structure of histidinol dehydrogenase from elizabethkingia anophelis 0.9531 1 424
5vlc-assembly2.cif.gz_D crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidinol 0.9502 1 424
6an0-assembly1.cif.gz_A-2 crystal structure of histidinol dehydrogenase from elizabethkingia anophelis 0.9487 1 424
5vlc-assembly2.cif.gz_D crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidinol 0.9458 1 424
5vld-assembly1.cif.gz_A crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidine and nad+ 0.9451 1 424
ID Description Score Start End Superfamily
5vlbA03 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 1.001 388 424 1.20.5.1300
6an0A03 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9968 388 424 1.20.5.1300
4g09A03 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9888 388 424 1.20.5.1300
1k75A02 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9883 388 424 1.20.5.1300
1k75B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9739 232 374 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A7Y2NMK2-F1-model_v4 Histidinol dehydrogenase (EC 1.1.1.23) 0.9856 1 221 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A3B1BIZ3-F1-model_v4 Histidinol dehydrogenase (EC 1.1.1.23) 0.9825 1 339 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A7W1FG50-F1-model_v4 Histidinol dehydrogenase (EC 1.1.1.23) 0.9819 1 313 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A3B1BIZ3-F1-model_v4 Histidinol dehydrogenase (EC 1.1.1.23) 0.9797 1 339 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A4Q5TWG6-F1-model_v4 Histidinol dehydrogenase (EC 1.1.1.23) 0.9796 1 324 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287

Feature Viewer

pLDDT pTM Quality
94.07 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map