F302260
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 196 | 140 | 160 | 418 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2582581278|2585143468 |
| Length | 443 |
| Sequence | KLNNLKTLNGSKKGLKNSTMKIYRYPTKDTWKDLVKRPVLEQKEISGLITEIFIEVEKKGDEALIEFNKKFDKAETRSIKVSDAEIQEAENQIQDELKQAIQQAKENISIFHASQKQEIQKIETTKGVVCWRENRAVESVGIYIPGGTAPLFSTVLMLAVPANLAGCKEIILCTPPDKNGNVNPAILYAAKLCGVSKIFKTGGAQAVAAMTFGTESIPSVNKIFGPGNQFVVAAKEYAQRYGVAIDMPAGPSEVLVIADEKAVPDFCAADLLSQAEHGSDSQVVFITTDFKVFEETIKAVGQQVRDLPRNEFAGQALENSSFILVDSLEEALEFSNLYAPEHLILAIDNFEKYIPEVQNAGSVFLGNYSCESAGDYASGTNHTLPTNAYAKNYSGVSLDSFVKKITFQHLSKEGLQNLGKTIELMAEAEGLFAHKNAVSIRLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 2 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 3 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 4 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 5 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 6 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 7 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 8 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 9 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 10 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 11 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 12 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 13 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 14 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 15 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 16 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 17 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 18 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 19 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 20 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 21 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 22 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 23 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 24 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 25 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 26 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 27 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 28 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 29 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 30 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 31 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 32 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 33 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 34 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 35 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 36 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 37 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 38 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 39 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 73 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 93 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 94 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 95 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 96 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 97 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 98 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 99 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 100 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 102 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 103 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 104 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 105 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 106 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 107 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 108 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 109 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 110 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 111 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 125 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 126 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 128 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 129 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 130 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 131 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 132 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 133 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 134 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 135 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 136 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 137 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 138 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 139 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 140 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.63 |
| Metatranscriptomes | 0 |
| Isolates | 18.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.02 |
| Bulb | 0 |
| Endosphere | 1.53 |
| Nodule | 0.51 |
| Rhizoplane | 3.06 |
| Rhizosphere | 79.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10259182 | 3300003322 | Bacteria | 4865 |
| 2 | rootL2_10286064 | 3300003322 | Bacteria | 2405 |
| 3 | rootH1_10035284 | 3300003323 | Bacteria | 47456 |
| 4 | Ga0065714_10064750 | 3300005288 | Bacteria | 20200 |
| 5 | Ga0065704_10083999 | 3300005289 | Bacteria | 3388 |
| 6 | Ga0065704_10086470 | 3300005289 | Bacteria | 3116 |
| 7 | Ga0065704_10104178 | 3300005289 | Bacteria | 2149 |
| 8 | Ga0070658_10011471 | 3300005327 | Bacteria | 7106 |
| 9 | Ga0070670_100038708 | 3300005331 | Bacteria | 4100 |
| 10 | Ga0070689_100070686 | 3300005340 | Bacteria | 2725 |
| 11 | Ga0070675_100240499 | 3300005354 | Bacteria | 1582 |
| 12 | Ga0070688_100167759 | 3300005365 | Bacteria | 1513 |
| 13 | Ga0070685_10100032 | 3300005466 | Bacteria | 1770 |
| 14 | Ga0070679_100007656 | 3300005530 | Bacteria | 10111 |
| 15 | Ga0068853_100016539 | 3300005539 | Bacteria | 6074 |
| 16 | Ga0068853_100116334 | 3300005539 | Bacteria | 2380 |
| 17 | Ga0070664_100014454 | 3300005564 | Bacteria | 6435 |
| 18 | Ga0068857_100135658 | 3300005577 | Bacteria | 2222 |
| 19 | Ga0068856_100007967 | 3300005614 | Bacteria | 10348 |
| 20 | Ga0068859_100014329 | 3300005617 | Bacteria | 7953 |
| 21 | Ga0068863_100015360 | 3300005841 | Bacteria | 7359 |
| 22 | Ga0068860_100011274 | 3300005843 | Bacteria | 8808 |
| 23 | Ga0068860_100011999 | 3300005843 | Bacteria | 8534 |
| 24 | Ga0068862_100010385 | 3300005844 | Bacteria | 7684 |
| 25 | Ga0068862_100025020 | 3300005844 | Bacteria | 5011 |
| 26 | Ga0068862_100032995 | 3300005844 | Bacteria | 4374 |
| 27 | Ga0068862_100141254 | 3300005844 | Bacteria | 2137 |
| 28 | Ga0068871_100069523 | 3300006358 | Bacteria | 2892 |
| 29 | Ga0068865_100057864 | 3300006881 | Unclassified | 2706 |
| 30 | Ga0097620_100014329 | 3300006931 | Bacteria | 7953 |
| 31 | Ga0105247_10010386 | 3300009101 | Bacteria | 5633 |
| 32 | Ga0105247_10012510 | 3300009101 | Bacteria | 5098 |
| 33 | Ga0105243_10002194 | 3300009148 | Bacteria | 16455 |
| 34 | Ga0105242_10034951 | 3300009176 | Bacteria | 4030 |
| 35 | Ga0105242_10180598 | 3300009176 | Bacteria | 1861 |
| 36 | Ga0105248_10424004 | 3300009177 | Bacteria | 1498 |
| 37 | Ga0105249_10086328 | 3300009553 | Bacteria | 2926 |
| 38 | Ga0105249_10183811 | 3300009553 | Bacteria | 2036 |
| 39 | Ga0105249_10397832 | 3300009553 | Bacteria | 1407 |
| 40 | Ga0157373_10000036 | 3300013100 | Bacteria | 122723 |
| 41 | Ga0157371_10040872 | 3300013102 | Unclassified | 3310 |
| 42 | Ga0157370_10029883 | 3300013104 | Bacteria | 5342 |
| 43 | Ga0157369_10060902 | 3300013105 | Bacteria | 4070 |
| 44 | Ga0163162_10013133 | 3300013306 | Bacteria | 8087 |
| 45 | Ga0157375_10000910 | 3300013308 | Bacteria | 25705 |
| 46 | Ga0157375_10033652 | 3300013308 | Bacteria | 4873 |
| 47 | Ga0163163_10048819 | 3300014325 | Bacteria | 4163 |
| 48 | Ga0157380_10019234 | 3300014326 | Bacteria | 5088 |
| 49 | Ga0182008_10000011 | 3300014497 | Bacteria | 297770 |
| 50 | Ga0182006_1000011 | 3300015261 | Bacteria | 408647 |
| 51 | Ga0163161_10020644 | 3300017792 | Bacteria | 4625 |
| 52 | Ga0163161_10028968 | 3300017792 | Bacteria | 3935 |
| 53 | Ga0207710_10002439 | 3300025900 | Bacteria | 8644 |
| 54 | Ga0207705_10020747 | 3300025909 | Bacteria | 4689 |
| 55 | Ga0207707_10019047 | 3300025912 | Bacteria | 5989 |
| 56 | Ga0207671_10098842 | 3300025914 | Bacteria | 2208 |
| 57 | Ga0207650_10175091 | 3300025925 | Bacteria | 1707 |
| 58 | Ga0207706_10110622 | 3300025933 | Bacteria | 2417 |
| 59 | Ga0207686_10028042 | 3300025934 | Unclassified | 3305 |
| 60 | Ga0207711_10007653 | 3300025941 | Bacteria | 9036 |
| 61 | Ga0207712_10005109 | 3300025961 | Bacteria | 8305 |
| 62 | Ga0207677_10128546 | 3300026023 | Bacteria | 1919 |
| 63 | Ga0207702_10005976 | 3300026078 | Bacteria | 10568 |
| 64 | Ga0207641_10008776 | 3300026088 | Bacteria | 8347 |
| 65 | Ga0207648_10049586 | 3300026089 | Bacteria | 3673 |
| 66 | Ga0207674_10066764 | 3300026116 | Bacteria | 3622 |
| 67 | Ga0268265_10068604 | 3300028380 | Bacteria | 2750 |
| 68 | Ga0268265_10179643 | 3300028380 | Bacteria | 1817 |
| 69 | Ga0268264_10003107 | 3300028381 | Bacteria | 14381 |
| 70 | Ga0268264_10138927 | 3300028381 | Bacteria | 2164 |
| 71 | Ga0265332_10017516 | 3300031238 | Bacteria | 3161 |
| 72 | Ga0265327_10000972 | 3300031251 | Bacteria | 40973 |
| 73 | Ga0265316_10002342 | 3300031344 | Bacteria | 19745 |
| 74 | Ga0265342_10000007 | 3300031712 | Bacteria | 228257 |
| 75 | Ga0307405_10014862 | 3300031731 | Bacteria | 4200 |
| 76 | Ga0307405_10050840 | 3300031731 | Bacteria | 2569 |
| 77 | Ga0307413_10083712 | 3300031824 | Bacteria | 2053 |
| 78 | Ga0307410_10001320 | 3300031852 | Bacteria | 11079 |
| 79 | Ga0307410_10003161 | 3300031852 | Bacteria | 8191 |
| 80 | Ga0307406_10008639 | 3300031901 | Bacteria | 5692 |
| 81 | Ga0307406_10038538 | 3300031901 | Bacteria | 2959 |
| 82 | Ga0307407_10004137 | 3300031903 | Bacteria | 6111 |
| 83 | Ga0307407_10011863 | 3300031903 | Bacteria | 4167 |
| 84 | Ga0307412_10000012 | 3300031911 | Bacteria | 404180 |
| 85 | Ga0307412_10004438 | 3300031911 | Bacteria | 7817 |
| 86 | Ga0307412_10012634 | 3300031911 | Bacteria | 4928 |
| 87 | Ga0307409_100001249 | 3300031995 | Bacteria | 12255 |
| 88 | Ga0307409_100144012 | 3300031995 | Bacteria | 2058 |
| 89 | Ga0307416_100000010 | 3300032002 | Bacteria | 320243 |
| 90 | Ga0307416_100044187 | 3300032002 | Bacteria | 3496 |
| 91 | Ga0307416_100063286 | 3300032002 | Archaea | 3029 |
| 92 | Ga0307414_10000009 | 3300032004 | Bacteria | 359782 |
| 93 | Ga0307414_10003230 | 3300032004 | Bacteria | 8679 |
| 94 | Ga0307414_10012409 | 3300032004 | Bacteria | 5037 |
| 95 | Ga0307414_10081015 | 3300032004 | Bacteria | 2375 |
| 96 | Ga0307411_10002924 | 3300032005 | Bacteria | 7745 |
| 97 | Ga0307411_10200819 | 3300032005 | Bacteria | 1531 |
| 98 | Ga0307415_100059949 | 3300032126 | Bacteria | 2627 |
| 99 | Ga0307415_100134163 | 3300032126 | Archaea | 1880 |
| 100 | Ga0307415_100161547 | 3300032126 | Bacteria | 1737 |
| 101 | Ga0451791_0681083 | 3300041451 | Bacteria | 1832 |
| 102 | Ga0451577_0044414 | 3300042876 | Bacteria | 3979 |
| 103 | Ga0451577_0101103 | 3300042876 | Bacteria | 2576 |
| 104 | Ga0453683_0020539 | 3300044673 | Bacteria | 4219 |
| 105 | Ga0453684_0000557 | 3300044712 | Bacteria | 140566 |
| 106 | Ga0453684_0001834 | 3300044712 | Bacteria | 55525 |
| 107 | Ga0453684_0004470 | 3300044712 | Bacteria | 29452 |
| 108 | Ga0453684_0009766 | 3300044712 | Bacteria | 16663 |
| 109 | Ga0453684_0034212 | 3300044712 | Bacteria | 7060 |
| 110 | Ga0453684_0068852 | 3300044712 | Bacteria | 4491 |
| 111 | Ga0453684_0071008 | 3300044712 | Bacteria | 4405 |
| 112 | Ga0453684_0106561 | 3300044712 | Bacteria | 3415 |
| 113 | Ga0453684_0137881 | 3300044712 | Bacteria | 2918 |
| 114 | Ga0453684_0269667 | 3300044712 | Bacteria | 1946 |
| 115 | Ga0451576_0007064 | 3300045051 | Bacteria | 13567 |
| 116 | Ga0495627_000003 | 3300046453 | Bacteria | 704557 |
| 117 | Ga0495638_0127220 | 3300046460 | Bacteria | 1501 |
| 118 | Ga0495606_0019868 | 3300046507 | Bacteria | 4975 |
| 119 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 120 | Ga0495632_0008157 | 3300046519 | Bacteria | 6472 |
| 121 | Ga0495643_0002373 | 3300046522 | Bacteria | 15070 |
| 122 | Ga0495663_0000151 | 3300046525 | Bacteria | 28138 |
| 123 | Ga0495654_0000001 | 3300046530 | Bacteria | 1513197 |
| 124 | Ga0495609_0000134 | 3300046538 | Bacteria | 79757 |
| 125 | Ga0495633_0000008 | 3300046558 | Bacteria | 301830 |
| 126 | Ga0495633_0004351 | 3300046558 | Bacteria | 9044 |
| 127 | Ga0495668_0000292 | 3300046616 | Bacteria | 68757 |
| 128 | Ga0495668_0000592 | 3300046616 | Bacteria | 44008 |
| 129 | Ga0495668_0000751 | 3300046616 | Bacteria | 38311 |
| 130 | Ga0495625_0000781 | 3300046660 | Bacteria | 44239 |
| 131 | Ga0495625_0046734 | 3300046660 | Bacteria | 3122 |
| 132 | Ga0495686_0000118 | 3300047472 | Bacteria | 165897 |
| 133 | Ga0495686_0000884 | 3300047472 | Bacteria | 38050 |
| 134 | Ga0495686_0028549 | 3300047472 | Bacteria | 3633 |
| 135 | Ga0496102_0031353 | 3300048905 | Bacteria | 4768 |
| 136 | Ga0496104_0332711 | 3300048907 | Bacteria | 1432 |
| 137 | Ga0496109_0195580 | 3300048912 | Unclassified | 1901 |
| 138 | Ga0496115_0007421 | 3300048918 | Bacteria | 8067 |
| 139 | Ga0496115_0053220 | 3300048918 | Bacteria | 3248 |
| 140 | Ga0496116_0000053 | 3300048919 | Bacteria | 291837 |
| 141 | Ga0496117_0000050 | 3300048920 | Bacteria | 292727 |
| 142 | Ga0496118_0000044 | 3300048921 | Bacteria | 283524 |
| 143 | Ga0496119_0000002 | 3300048922 | Bacteria | 738385 |
| 144 | Ga0496121_0035012 | 3300048924 | Bacteria | 4507 |
| 145 | Ga0496122_0000188 | 3300048925 | Bacteria | 143808 |
| 146 | Ga0496122_0000191 | 3300048925 | Bacteria | 140173 |
| 147 | Ga0496122_0000538 | 3300048925 | Bacteria | 78492 |
| 148 | Ga0496122_0000769 | 3300048925 | Bacteria | 61918 |
| 149 | Ga0496122_0037488 | 3300048925 | Bacteria | 3901 |
| 150 | Ga0496123_0000636 | 3300048926 | Bacteria | 58636 |
| 151 | Ga0496123_0003634 | 3300048926 | Bacteria | 17066 |
| 152 | Ga0496123_0005816 | 3300048926 | Bacteria | 12234 |
| 153 | Ga0496124_0001056 | 3300048927 | Bacteria | 43505 |
| 154 | Ga0496125_0000310 | 3300048928 | Bacteria | 95700 |
| 155 | Ga0496125_0007782 | 3300048928 | Bacteria | 11336 |
| 156 | Ga0496125_0008192 | 3300048928 | Bacteria | 10999 |
| 157 | Ga0496126_0000660 | 3300048929 | Bacteria | 63892 |
| 158 | Ga0500556_0021008 | 3300053104 | Bacteria | 2098 |
| 159 | Ga0500616_0000849 | 3300053153 | Bacteria | 34031 |
| 160 | Ga0500627_0004661 | 3300053158 | Bacteria | 4438 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048925 | Ga0496122_0000769 | Ga0496122_0000769_50676_51950 | 321 |
| 2 | 3300048926 | Ga0496123_0005816 | Ga0496123_0005816_5490_6764 | 321 |
| 3 | 3300048929 | Ga0496126_0000660 | Ga0496126_0000660_4276_5550 | 361 |
| 4 | 3300046525 | Ga0495663_0000151 | Ga0495663_0000151_1720_2994 | 369 |
| 5 | 3300048905 | Ga0496102_0031353 | Ga0496102_0031353_3370_4674 | 372 |
| 6 | 3300048919 | Ga0496116_0000053 | Ga0496116_0000053_160686_161990 | 372 |
| 7 | 3300048920 | Ga0496117_0000050 | Ga0496117_0000050_278649_279953 | 372 |
| 8 | 3300048921 | Ga0496118_0000044 | Ga0496118_0000044_12802_14106 | 372 |
| 9 | 3300048922 | Ga0496119_0000002 | Ga0496119_0000002_14980_16284 | 372 |
| 10 | 3300048925 | Ga0496122_0000191 | Ga0496122_0000191_13108_14412 | 372 |
| 11 | 3300048926 | Ga0496123_0000636 | Ga0496123_0000636_12794_14098 | 372 |
| 12 | 3300048927 | Ga0496124_0001056 | Ga0496124_0001056_10413_11717 | 372 |
| 13 | 3300048928 | Ga0496125_0007782 | Ga0496125_0007782_7134_8438 | 372 |
| 14 | 3300003323 | rootH1_10035284 | rootH1_1003528413 | 373 |
| 15 | 3300013100 | Ga0157373_10000036 | Ga0157373_10000036108 | 376 |
| 16 | 3300013105 | Ga0157369_10060902 | Ga0157369_100609022 | 376 |
| 17 | 3300046558 | Ga0495633_0004351 | Ga0495633_0004351_4446_5741 | 376 |
| 18 | 3300046660 | Ga0495625_0000781 | Ga0495625_0000781_33331_34626 | 376 |
| 19 | 3300048928 | Ga0496125_0008192 | Ga0496125_0008192_3643_4929 | 376 |
| 20 | 3300003322 | rootL2_10286064 | rootL2_102860642 | 377 |
| 21 | 3300046530 | Ga0495654_0000001 | Ga0495654_0000001_738580_739872 | 377 |
| 22 | 3300046538 | Ga0495609_0000134 | Ga0495609_0000134_71756_73030 | 381 |
| 23 | 3300047472 | Ga0495686_0000884 | Ga0495686_0000884_16107_17396 | 381 |
| 24 | 3300014497 | Ga0182008_10000011 | Ga0182008_1000001112 | 382 |
| 25 | 3300032004 | Ga0307414_10000009 | Ga0307414_10000009165 | 383 |
| 26 | 3300009553 | Ga0105249_10183811 | Ga0105249_101838112 | 384 |
| 27 | 3300013308 | Ga0157375_10000910 | Ga0157375_1000091018 | 385 |
| 28 | 3300046507 | Ga0495606_0019868 | Ga0495606_0019868_417_1691 | 386 |
| 29 | 3300048925 | Ga0496122_0000538 | Ga0496122_0000538_14578_15855 | 388 |
| 30 | 3300031238 | Ga0265332_10017516 | Ga0265332_100175162 | 389 |
| 31 | 3300031344 | Ga0265316_10002342 | Ga0265316_100023429 | 389 |
| 32 | 3300031712 | Ga0265342_10000007 | Ga0265342_10000007100 | 389 |
| 33 | 3300044712 | Ga0453684_0269667 | Ga0453684_0269667_32_1225 | 392 |
| 34 | 3300032126 | Ga0307415_100161547 | Ga0307415_1001615472 | 396 |
| 35 | 3300047472 | Ga0495686_0000118 | Ga0495686_0000118_129484_130767 | 403 |
| 36 | 3300048924 | Ga0496121_0035012 | Ga0496121_0035012_2056_3330 | 403 |
| 37 | 3300042876 | Ga0451577_0101103 | Ga0451577_0101103_214_1503 | 404 |
| 38 | 3300044673 | Ga0453683_0020539 | Ga0453683_0020539_882_2171 | 404 |
| 39 | 3300044712 | Ga0453684_0000557 | Ga0453684_0000557_120867_122156 | 404 |
| 40 | 3300048907 | Ga0496104_0332711 | Ga0496104_0332711_179_1408 | 405 |
| 41 | 3300031911 | Ga0307412_10000012 | Ga0307412_10000012197 | 407 |
| 42 | 3300032004 | Ga0307414_10081015 | Ga0307414_100810152 | 407 |
| 43 | 3300053104 | Ga0500556_0021008 | Ga0500556_0021008_628_1917 | 407 |
| 44 | 3300032002 | Ga0307416_100000010 | Ga0307416_100000010169 | 408 |
| 45 | 3300053158 | Ga0500627_0004661 | Ga0500627_0004661_547_1836 | 409 |
| 46 | 3300046616 | Ga0495668_0000592 | Ga0495668_0000592_21199_22488 | 411 |
| 47 | 3300046453 | Ga0495627_000003 | Ga0495627_000003_380222_381514 | 413 |
| 48 | 3300046460 | Ga0495638_0127220 | Ga0495638_0127220_68_1342 | 413 |
| 49 | 3300047472 | Ga0495686_0028549 | Ga0495686_0028549_17_1309 | 413 |
| 50 | 3300053153 | Ga0500616_0000849 | Ga0500616_0000849_5680_6969 | 414 |
| 51 | 3300005530 | Ga0070679_100007656 | Ga0070679_1000076563 | 415 |
| 52 | 3300025912 | Ga0207707_10019047 | Ga0207707_100190472 | 415 |
| 53 | 3300044712 | Ga0453684_0009766 | Ga0453684_0009766_1548_2822 | 415 |
| 54 | 3300045051 | Ga0451576_0007064 | Ga0451576_0007064_12116_13390 | 415 |
| 55 | 3300005539 | Ga0068853_100116334 | Ga0068853_1001163342 | 416 |
| 56 | 3300025914 | Ga0207671_10098842 | Ga0207671_100988422 | 416 |
| 57 | iso_pu_bacteria | 2585428095 | 2587866775 | 420 |
| 58 | iso_pu_bacteria | 2585428183 | 2588213189 | 420 |
| 59 | iso_pu_bacteria | 2585428184 | 2588219805 | 420 |
| 60 | iso_pu_bacteria | 2585428185 | 2588223922 | 420 |
| 61 | iso_pu_bacteria | 2728369107 | 2729198584 | 420 |
| 62 | iso_pu_bacteria | 2765235839 | 2765572571 | 420 |
| 63 | iso_pu_bacteria | 2816332188 | 2816872922 | 420 |
| 64 | iso_pu_bacteria | 2842083920 | 2842084179 | 420 |
| 65 | iso_pu_bacteria | 2871720351 | 2871723724 | 420 |
| 66 | iso_pu_bacteria | 2889290771 | 2889291701 | 420 |
| 67 | iso_pu_bacteria | 2905999023 | 2906000814 | 420 |
| 68 | iso_pu_bacteria | 2919399522 | 2919402893 | 420 |
| 69 | iso_pu_bacteria | 2945924605 | 2945927286 | 420 |
| 70 | iso_pu_bacteria | 2511231000 | 2511234751 | 421 |
| 71 | iso_pu_bacteria | 2582581281 | 2585158509 | 421 |
| 72 | iso_pu_bacteria | 2582581282 | 2585162853 | 421 |
| 73 | iso_pu_bacteria | 2582581873 | 2585424756 | 421 |
| 74 | iso_pu_bacteria | 2585428045 | 2587680657 | 421 |
| 75 | iso_pu_bacteria | 2585428060 | 2587747863 | 421 |
| 76 | iso_pu_bacteria | 2585428115 | 2587942918 | 421 |
| 77 | iso_pu_bacteria | 2585428182 | 2588208245 | 421 |
| 78 | iso_pu_bacteria | 2585428187 | 2588233481 | 421 |
| 79 | iso_pu_bacteria | 2588253712 | 2588446445 | 421 |
| 80 | iso_pu_bacteria | 2588254255 | 2590600847 | 421 |
| 81 | iso_pu_bacteria | 2588254257 | 2590611892 | 421 |
| 82 | iso_pu_bacteria | 2738543014 | 2739254425 | 421 |
| 83 | iso_pu_bacteria | 2739367874 | 2740057597 | 421 |
| 84 | iso_pu_bacteria | 2751185877 | 2753672697 | 421 |
| 85 | iso_pu_bacteria | 2946019816 | 2946021399 | 421 |
| 86 | iso_pu_bacteria | 2977243572 | 2977246216 | 421 |
| 87 | iso_pu_bacteria | 2984572630 | 2984575973 | 421 |
| 88 | iso_pu_bacteria | 2984606641 | 2984609428 | 421 |
| 89 | iso_pu_bacteria | 2993372514 | 2993373503 | 421 |
| 90 | iso_pu_bacteria | 2993480792 | 2993484186 | 421 |
| 91 | iso_pu_bacteria | 2958512119 | 2958513292 | 422 |
| 92 | 3300009177 | Ga0105248_10424004 | Ga0105248_104240042 | 423 |
| 93 | 3300048912 | Ga0496109_0195580 | Ga0496109_0195580_317_1606 | 423 |
| 94 | 3300005843 | Ga0068860_100011274 | Ga0068860_1000112749 | 424 |
| 95 | 3300005844 | Ga0068862_100025020 | Ga0068862_1000250205 | 424 |
| 96 | 3300006881 | Ga0068865_100057864 | Ga0068865_1000578642 | 424 |
| 97 | 3300009101 | Ga0105247_10010386 | Ga0105247_100103862 | 424 |
| 98 | 3300009101 | Ga0105247_10012510 | Ga0105247_100125102 | 424 |
| 99 | 3300009176 | Ga0105242_10034951 | Ga0105242_100349514 | 424 |
| 100 | 3300009553 | Ga0105249_10086328 | Ga0105249_100863283 | 424 |
| 101 | 3300009553 | Ga0105249_10397832 | Ga0105249_103978321 | 424 |
| 102 | 3300013102 | Ga0157371_10040872 | Ga0157371_100408724 | 424 |
| 103 | 3300013104 | Ga0157370_10029883 | Ga0157370_100298832 | 424 |
| 104 | 3300014325 | Ga0163163_10048819 | Ga0163163_100488193 | 424 |
| 105 | 3300015261 | Ga0182006_1000011 | Ga0182006_1000011242 | 424 |
| 106 | 3300025900 | Ga0207710_10002439 | Ga0207710_100024392 | 424 |
| 107 | 3300025934 | Ga0207686_10028042 | Ga0207686_100280422 | 424 |
| 108 | 3300025941 | Ga0207711_10007653 | Ga0207711_100076533 | 424 |
| 109 | 3300025961 | Ga0207712_10005109 | Ga0207712_100051098 | 424 |
| 110 | 3300026023 | Ga0207677_10128546 | Ga0207677_101285462 | 424 |
| 111 | 3300026088 | Ga0207641_10008776 | Ga0207641_100087763 | 424 |
| 112 | 3300028380 | Ga0268265_10068604 | Ga0268265_100686041 | 424 |
| 113 | 3300028381 | Ga0268264_10003107 | Ga0268264_100031072 | 424 |
| 114 | 3300028381 | Ga0268264_10138927 | Ga0268264_101389272 | 424 |
| 115 | 3300046512 | Ga0495610_0000001 | Ga0495610_0000001_1447160_1448434 | 424 |
| 116 | 3300046558 | Ga0495633_0000008 | Ga0495633_0000008_169513_170787 | 424 |
| 117 | 3300046616 | Ga0495668_0000751 | Ga0495668_0000751_34624_35898 | 424 |
| 118 | 3300048925 | Ga0496122_0037488 | Ga0496122_0037488_1616_2890 | 424 |
| 119 | iso_pu_bacteria | 2582581278 | 2585143468 | 424 |
| 120 | 3300003322 | rootL2_10259182 | rootL2_102591823 | 425 |
| 121 | 3300005288 | Ga0065714_10064750 | Ga0065714_100647503 | 425 |
| 122 | 3300005289 | Ga0065704_10083999 | Ga0065704_100839993 | 425 |
| 123 | 3300005289 | Ga0065704_10086470 | Ga0065704_100864703 | 425 |
| 124 | 3300005289 | Ga0065704_10104178 | Ga0065704_101041782 | 425 |
| 125 | 3300005327 | Ga0070658_10011471 | Ga0070658_100114712 | 425 |
| 126 | 3300005331 | Ga0070670_100038708 | Ga0070670_1000387083 | 425 |
| 127 | 3300005340 | Ga0070689_100070686 | Ga0070689_1000706863 | 425 |
| 128 | 3300005354 | Ga0070675_100240499 | Ga0070675_1002404992 | 425 |
| 129 | 3300005365 | Ga0070688_100167759 | Ga0070688_1001677591 | 425 |
| 130 | 3300005466 | Ga0070685_10100032 | Ga0070685_101000322 | 425 |
| 131 | 3300005539 | Ga0068853_100016539 | Ga0068853_1000165396 | 425 |
| 132 | 3300005564 | Ga0070664_100014454 | Ga0070664_1000144544 | 425 |
| 133 | 3300005577 | Ga0068857_100135658 | Ga0068857_1001356582 | 425 |
| 134 | 3300005614 | Ga0068856_100007967 | Ga0068856_10000796712 | 425 |
| 135 | 3300005617 | Ga0068859_100014329 | Ga0068859_1000143293 | 425 |
| 136 | 3300005841 | Ga0068863_100015360 | Ga0068863_1000153608 | 425 |
| 137 | 3300005843 | Ga0068860_100011999 | Ga0068860_1000119996 | 425 |
| 138 | 3300005844 | Ga0068862_100010385 | Ga0068862_1000103856 | 425 |
| 139 | 3300005844 | Ga0068862_100032995 | Ga0068862_1000329952 | 425 |
| 140 | 3300005844 | Ga0068862_100141254 | Ga0068862_1001412542 | 425 |
| 141 | 3300006358 | Ga0068871_100069523 | Ga0068871_1000695232 | 425 |
| 142 | 3300006931 | Ga0097620_100014329 | Ga0097620_1000143295 | 425 |
| 143 | 3300009148 | Ga0105243_10002194 | Ga0105243_1000219413 | 425 |
| 144 | 3300009176 | Ga0105242_10180598 | Ga0105242_101805982 | 425 |
| 145 | 3300013306 | Ga0163162_10013133 | Ga0163162_100131334 | 425 |
| 146 | 3300013308 | Ga0157375_10033652 | Ga0157375_100336522 | 425 |
| 147 | 3300014326 | Ga0157380_10019234 | Ga0157380_100192344 | 425 |
| 148 | 3300017792 | Ga0163161_10020644 | Ga0163161_100206444 | 425 |
| 149 | 3300017792 | Ga0163161_10028968 | Ga0163161_100289683 | 425 |
| 150 | 3300025909 | Ga0207705_10020747 | Ga0207705_100207472 | 425 |
| 151 | 3300025925 | Ga0207650_10175091 | Ga0207650_101750912 | 425 |
| 152 | 3300025933 | Ga0207706_10110622 | Ga0207706_101106222 | 425 |
| 153 | 3300026078 | Ga0207702_10005976 | Ga0207702_1000597613 | 425 |
| 154 | 3300026089 | Ga0207648_10049586 | Ga0207648_100495863 | 425 |
| 155 | 3300026116 | Ga0207674_10066764 | Ga0207674_100667643 | 425 |
| 156 | 3300028380 | Ga0268265_10179643 | Ga0268265_101796432 | 425 |
| 157 | 3300031251 | Ga0265327_10000972 | Ga0265327_1000097219 | 425 |
| 158 | 3300031731 | Ga0307405_10014862 | Ga0307405_100148624 | 425 |
| 159 | 3300031731 | Ga0307405_10050840 | Ga0307405_100508402 | 425 |
| 160 | 3300031824 | Ga0307413_10083712 | Ga0307413_100837122 | 425 |
| 161 | 3300031852 | Ga0307410_10001320 | Ga0307410_100013204 | 425 |
| 162 | 3300031852 | Ga0307410_10003161 | Ga0307410_100031619 | 425 |
| 163 | 3300031901 | Ga0307406_10008639 | Ga0307406_100086396 | 425 |
| 164 | 3300031901 | Ga0307406_10038538 | Ga0307406_100385382 | 425 |
| 165 | 3300031903 | Ga0307407_10004137 | Ga0307407_100041374 | 425 |
| 166 | 3300031903 | Ga0307407_10011863 | Ga0307407_100118632 | 425 |
| 167 | 3300031911 | Ga0307412_10004438 | Ga0307412_100044389 | 425 |
| 168 | 3300031911 | Ga0307412_10012634 | Ga0307412_100126342 | 425 |
| 169 | 3300031995 | Ga0307409_100001249 | Ga0307409_10000124911 | 425 |
| 170 | 3300031995 | Ga0307409_100144012 | Ga0307409_1001440122 | 425 |
| 171 | 3300032002 | Ga0307416_100044187 | Ga0307416_1000441873 | 425 |
| 172 | 3300032002 | Ga0307416_100063286 | Ga0307416_1000632862 | 425 |
| 173 | 3300032004 | Ga0307414_10003230 | Ga0307414_100032309 | 425 |
| 174 | 3300032004 | Ga0307414_10012409 | Ga0307414_100124095 | 425 |
| 175 | 3300032005 | Ga0307411_10002924 | Ga0307411_100029249 | 425 |
| 176 | 3300032005 | Ga0307411_10200819 | Ga0307411_102008192 | 425 |
| 177 | 3300032126 | Ga0307415_100059949 | Ga0307415_1000599492 | 425 |
| 178 | 3300032126 | Ga0307415_100134163 | Ga0307415_1001341632 | 425 |
| 179 | 3300041451 | Ga0451791_0681083 | Ga0451791_0681083_435_1742 | 425 |
| 180 | 3300042876 | Ga0451577_0044414 | Ga0451577_0044414_2020_3309 | 425 |
| 181 | 3300044712 | Ga0453684_0001834 | Ga0453684_0001834_13814_15094 | 425 |
| 182 | 3300044712 | Ga0453684_0004470 | Ga0453684_0004470_7861_9156 | 425 |
| 183 | 3300044712 | Ga0453684_0034212 | Ga0453684_0034212_3727_5016 | 425 |
| 184 | 3300044712 | Ga0453684_0068852 | Ga0453684_0068852_2300_3589 | 425 |
| 185 | 3300044712 | Ga0453684_0071008 | Ga0453684_0071008_2304_3593 | 425 |
| 186 | 3300044712 | Ga0453684_0106561 | Ga0453684_0106561_410_1690 | 425 |
| 187 | 3300044712 | Ga0453684_0137881 | Ga0453684_0137881_690_1979 | 425 |
| 188 | 3300046519 | Ga0495632_0008157 | Ga0495632_0008157_1380_2675 | 425 |
| 189 | 3300046522 | Ga0495643_0002373 | Ga0495643_0002373_12492_13784 | 425 |
| 190 | 3300046616 | Ga0495668_0000292 | Ga0495668_0000292_20584_21882 | 425 |
| 191 | 3300046660 | Ga0495625_0046734 | Ga0495625_0046734_1682_2974 | 425 |
| 192 | 3300048918 | Ga0496115_0007421 | Ga0496115_0007421_981_2270 | 425 |
| 193 | 3300048918 | Ga0496115_0053220 | Ga0496115_0053220_1489_2781 | 425 |
| 194 | 3300048925 | Ga0496122_0000188 | Ga0496122_0000188_22016_23293 | 425 |
| 195 | 3300048926 | Ga0496123_0003634 | Ga0496123_0003634_10502_11779 | 425 |
| 196 | 3300048928 | Ga0496125_0000310 | Ga0496125_0000310_26502_27794 | 425 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6an0-assembly1.cif.gz_A-2 | crystal structure of histidinol dehydrogenase from elizabethkingia anophelis | 0.9531 | 1 | 424 |
| 5vlc-assembly2.cif.gz_D | crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidinol | 0.9502 | 1 | 424 |
| 6an0-assembly1.cif.gz_A-2 | crystal structure of histidinol dehydrogenase from elizabethkingia anophelis | 0.9487 | 1 | 424 |
| 5vlc-assembly2.cif.gz_D | crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidinol | 0.9458 | 1 | 424 |
| 5vld-assembly1.cif.gz_A | crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidine and nad+ | 0.9451 | 1 | 424 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5vlbA03 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 1.001 | 388 | 424 | 1.20.5.1300 |
| 6an0A03 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.9968 | 388 | 424 | 1.20.5.1300 |
| 4g09A03 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.9888 | 388 | 424 | 1.20.5.1300 |
| 1k75A02 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.9883 | 388 | 424 | 1.20.5.1300 |
| 1k75B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9739 | 232 | 374 | 3.40.50.1980 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2NMK2-F1-model_v4 | Histidinol dehydrogenase (EC 1.1.1.23) | 0.9856 | 1 | 221 |
GO:0000105
GO:0004399 GO:0005829 GO:0046872 GO:0051287 |
| AF-A0A3B1BIZ3-F1-model_v4 | Histidinol dehydrogenase (EC 1.1.1.23) | 0.9825 | 1 | 339 |
GO:0000105
GO:0004399 GO:0005829 GO:0046872 GO:0051287 |
| AF-A0A7W1FG50-F1-model_v4 | Histidinol dehydrogenase (EC 1.1.1.23) | 0.9819 | 1 | 313 |
GO:0000105
GO:0004399 GO:0005829 GO:0046872 GO:0051287 |
| AF-A0A3B1BIZ3-F1-model_v4 | Histidinol dehydrogenase (EC 1.1.1.23) | 0.9797 | 1 | 339 |
GO:0000105
GO:0004399 GO:0005829 GO:0046872 GO:0051287 |
| AF-A0A4Q5TWG6-F1-model_v4 | Histidinol dehydrogenase (EC 1.1.1.23) | 0.9796 | 1 | 324 |
GO:0000105
GO:0004399 GO:0005829 GO:0046872 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar