F302206

General Info

Members Datasets Scaffolds Average Seq Length
196 154 392 189

Family's Representative Sequence

Representative Sequence 3300053088|Ga0500644_0002048|Ga0500644_0002048_1184_1834
Length 216
Sequence LPFAPASFRDCGRSRAPQGLRLNLRDIMAKINGNTIKPGMVLQVNGGLWVVTKASHVKPGKGGAFANVEAKNLETGNKLNERFRSEDKVERVTLEQQDFSYLFDNGDSLVFMNDQSYEQIELQKDWVGDERIPYLQEGMKVVIEMHEERPIGLSLPDQVNLEVVETEPTVKGQTASSSYKPAIANNGVRIMIPPYMGVGEKIVVDTTTGEYVRRAD

Samples

Sample ID Description Type Environment
1 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
32 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
56 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
72 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
87 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
88 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
92 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
97 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
102 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
133 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
134 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
135 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
136 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
140 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
143 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
144 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
145 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
146 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
147 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
148 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
149 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
150 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
151 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
152 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
153 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
154 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.37
Metatranscriptomes 0
Isolates 6.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.18
Nodule 0
Rhizoplane 1.53
Rhizosphere 76.02
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500644_0002048 3300053088 Bacteria 5111
2 rootH1_10173474 3300003323 Bacteria 2666
3 Ga0055536_1003623 3300003781 Bacteria 8241
4 Ga0055531_10021610 3300003794 Bacteria 2489
5 Ga0070658_10744488 3300005327 Bacteria 851
6 Ga0070670_100461559 3300005331 Bacteria 1126
7 Ga0070677_10209175 3300005333 Bacteria 946
8 Ga0070668_100050537 3300005347 Bacteria 3201
9 Ga0070659_100090374 3300005366 Bacteria 2454
10 Ga0070714_100037079 3300005435 Bacteria 4094
11 Ga0068867_100946334 3300005459 Bacteria 778
12 Ga0068867_101225625 3300005459 Bacteria 690
13 Ga0068853_100269009 3300005539 Bacteria 1569
14 Ga0070686_100062043 3300005544 Bacteria 2417
15 Ga0070664_100108428 3300005564 Bacteria 2422
16 Ga0068856_100044623 3300005614 Bacteria 4363
17 Ga0068859_100706027 3300005617 Bacteria 1099
18 Ga0068863_100081183 3300005841 Bacteria 3072
19 Ga0068863_100347955 3300005841 Bacteria 1443
20 Ga0068862_100088968 3300005844 Bacteria 2687
21 Ga0068862_100144273 3300005844 Bacteria 2115
22 Ga0070716_100375409 3300006173 Bacteria 1015
23 Ga0075434_101526143 3300006871 Bacteria 677
24 Ga0097620_100706015 3300006931 Bacteria 1099
25 Ga0114129_10340545 3300009147 Bacteria 1989
26 Ga0105248_11973691 3300009177 Bacteria 663
27 Ga0105249_10219301 3300009553 Bacteria 1871
28 Ga0105249_10292009 3300009553 Bacteria 1632
29 Ga0105246_11225807 3300011119 Bacteria 692
30 Ga0157371_10006560 3300013102 Bacteria 9568
31 Ga0157370_10255894 3300013104 Bacteria 1619
32 Ga0157369_10014643 3300013105 Bacteria 8848
33 Ga0157375_11287116 3300013308 Bacteria 859
34 Ga0157380_11934133 3300014326 Bacteria 651
35 Ga0183365_10001 3300015684 Bacteria 2090444
36 Ga0183360_10489 3300015689 Bacteria 1112
37 Ga0163161_10227108 3300017792 Bacteria 1448
38 Ga0213876_10158812 3300021384 Unclassified 1203
39 Ga0213875_10008890 3300021388 Bacteria 5122
40 Ga0209676_1000890 3300025292 Bacteria 38075
41 Ga0209050_1069074 3300025298 Bacteria 797
42 Ga0209257_1000060 3300025304 Bacteria 372267
43 Ga0207650_10185535 3300025925 Bacteria 1659
44 Ga0207650_10714763 3300025925 Bacteria 847
45 Ga0207664_10204582 3300025929 Bacteria 1705
46 Ga0207669_10662620 3300025937 Bacteria 855
47 Ga0207679_10078444 3300025945 Bacteria 2516
48 Ga0207668_10071912 3300025972 Bacteria 2472
49 Ga0207639_10045922 3300026041 Bacteria 3293
50 Ga0207641_10532323 3300026088 Bacteria 1144
51 Ga0207648_11266081 3300026089 Bacteria 693
52 Ga0207674_10401258 3300026116 Bacteria 1325
53 Ga0268266_10928260 3300028379 Bacteria 842
54 Ga0268265_10522049 3300028380 Bacteria 1123
55 Ga0268264_10247619 3300028381 Bacteria 1654
56 Ga0265337_1005839 3300028556 Bacteria 4824
57 Ga0265338_10067121 3300028800 Bacteria 3100
58 Ga0265327_10000140 3300031251 Bacteria 158935
59 Ga0307408_100797914 3300031548 Bacteria 857
60 Ga0316576_10414578 3300031727 Bacteria 997
61 Ga0316578_10387471 3300031728 Bacteria 829
62 Ga0307413_10255389 3300031824 Bacteria 1303
63 Ga0307406_10000294 3300031901 Bacteria 29383
64 Ga0307414_10026115 3300032004 Bacteria 3753
65 Ga0307414_10306668 3300032004 Bacteria 1345
66 Ga0307414_10334752 3300032004 Bacteria 1293
67 Ga0307414_10343555 3300032004 Bacteria 1278
68 Ga0307414_10901714 3300032004 Bacteria 810
69 Ga0373935_0516459 3300035692 Bacteria 868
70 Ga0373927_0010656 3300035695 Bacteria 6123
71 Ga0373925_0110099 3300037068 Bacteria 2126
72 Ga0395899_0109533 3300037312 Bacteria 1987
73 Ga0395905_0043821 3300037471 Bacteria 4198
74 Ga0436364_0735311 3300037853 Bacteria 1916
75 Ga0400483_045037 3300039062 Bacteria 1790
76 Ga0400483_102634 3300039062 Bacteria 1258
77 Ga0400483_130326 3300039062 Bacteria 2196
78 Ga0400483_142605 3300039062 Bacteria 1334
79 Ga0400483_171692 3300039062 Bacteria 1131
80 Ga0436365_0189939 3300039437 Bacteria 5374
81 Ga0436360_1227585 3300039438 Bacteria 924
82 Ga0436361_0300225 3300039447 Bacteria 2263
83 Ga0436361_0418506 3300039447 Bacteria 1004
84 Ga0436362_1155349 3300039453 Bacteria 1037
85 Ga0451802_0486427 3300041460 Bacteria 893
86 Ga0451843_0621948 3300041509 Bacteria 1127
87 Ga0466969_0000832 3300044656 Bacteria 16785
88 Ga0466972_0062570 3300044658 Bacteria 1783
89 Ga0466965_0374416 3300044683 Bacteria 783
90 Ga0466966_0019246 3300044684 Bacteria 4493
91 Ga0466961_0001151 3300044693 Bacteria 16238
92 Ga0466961_0011815 3300044693 Bacteria 5582
93 Ga0466971_0000569 3300044719 Bacteria 14591
94 Ga0466971_0034829 3300044719 Bacteria 2257
95 Ga0466970_0008470 3300044765 Bacteria 5177
96 Ga0466960_0252993 3300044901 Bacteria 979
97 Ga0466959_0000072 3300045049 Bacteria 66935
98 Ga0466958_0022861 3300045836 Bacteria 3665
99 Ga0495638_0047369 3300046460 Bacteria 2695
100 Ga0495638_0052260 3300046460 Bacteria 2545
101 Ga0495580_0490512 3300046472 Bacteria 821
102 Ga0495585_0131486 3300046492 Bacteria 1317
103 Ga0495585_0138875 3300046492 Bacteria 1274
104 Ga0495610_0000360 3300046512 Bacteria 47556
105 Ga0495610_0011721 3300046512 Bacteria 5331
106 Ga0495616_0029159 3300046513 Bacteria 2916
107 Ga0495620_0009084 3300046515 Bacteria 5304
108 Ga0495643_0065105 3300046522 Bacteria 1925
109 Ga0495643_0202584 3300046522 Bacteria 952
110 Ga0495648_0014778 3300046524 Bacteria 5689
111 Ga0495654_0000082 3300046530 Bacteria 108599
112 Ga0495633_0001025 3300046558 Bacteria 22844
113 Ga0495625_0001183 3300046660 Bacteria 33494
114 Ga0495625_0004949 3300046660 Bacteria 12381
115 Ga0495625_0008183 3300046660 Bacteria 8955
116 Ga0495671_0102690 3300046692 Bacteria 1397
117 Ga0495649_0011042 3300046694 Bacteria 5321
118 Ga0495660_0041538 3300046810 Bacteria 2545
119 Ga0495681_0098990 3300047470 Bacteria 1277
120 Ga0495686_0007790 3300047472 Bacteria 7971
121 Ga0496106_0197212 3300048909 Bacteria 1602
122 Ga0496115_0675973 3300048918 Bacteria 814
123 Ga0496122_0075059 3300048925 Bacteria 2388
124 Ga0496123_0000512 3300048926 Bacteria 67458
125 Ga0496124_0419494 3300048927 Bacteria 923
126 Ga0496125_0002197 3300048928 Bacteria 26053
127 Ga0496126_0401818 3300048929 Bacteria 1111
128 Ga0495678_001567 3300049459 Bacteria 17566
129 Ga0501031_0595181 3300049568 Bacteria 711
130 Ga0501033_0009299 3300049570 Bacteria 7571
131 Ga0501033_0191011 3300049570 Bacteria 1465
132 Ga0501034_0003497 3300049571 Bacteria 17835
133 Ga0501034_0047209 3300049571 Bacteria 4350
134 Ga0501034_1270437 3300049571 Bacteria 613
135 Ga0501037_0230193 3300049573 Bacteria 1301
136 Ga0501037_0601117 3300049573 Bacteria 739
137 Ga0501038_0326239 3300049574 Bacteria 1200
138 Ga0501039_0256138 3300049575 Bacteria 1376
139 Ga0501040_0117797 3300049576 Bacteria 1862
140 Ga0501042_0043346 3300049578 Bacteria 3204
141 Ga0501042_0223416 3300049578 Bacteria 1358
142 Ga0501042_0492691 3300049578 Bacteria 890
143 Ga0501043_0122578 3300049579 Bacteria 2039
144 Ga0501043_0123698 3300049579 Bacteria 2028
145 Ga0501048_0457178 3300049582 Bacteria 914
146 Ga0501068_0094120 3300049584 Bacteria 1851
147 Ga0501070_0342952 3300049586 Bacteria 1213
148 Ga0501071_0017016 3300049587 Bacteria 5007
149 Ga0501071_0049707 3300049587 Bacteria 3019
150 Ga0501075_0073816 3300049591 Bacteria 2580
151 Ga0501075_0267888 3300049591 Bacteria 1302
152 Ga0501075_0740984 3300049591 Bacteria 748
153 Ga0501238_024673 3300049671 Bacteria 859
154 Ga0501079_0063873 3300049741 Bacteria 2840
155 Ga0501080_0338756 3300049742 Bacteria 1359
156 Ga0501080_0795629 3300049742 Bacteria 830
157 Ga0501083_0107695 3300049744 Bacteria 1834
158 Ga0501035_0053549 3300049822 Bacteria 3608
159 Ga0501035_0071654 3300049822 Bacteria 3068
160 Ga0501035_0487059 3300049822 Bacteria 1016
161 Ga0501035_0989797 3300049822 Bacteria 662
162 Ga0501035_1115550 3300049822 Bacteria 615
163 Ga0501044_0001671 3300049823 Bacteria 26049
164 Ga0501044_0610064 3300049823 Bacteria 983
165 Ga0501045_0081419 3300049824 Bacteria 2387
166 nmdc:mga05p37_84449_c1 3300050507 Bacteria 3912
167 nmdc:mga08y16_707618_c1 3300050511 Bacteria 1006
168 nmdc:mga0n895_1008306_c1 3300050512 Bacteria 813
169 Ga0500635_0000422 3300053080 Bacteria 12500
170 Ga0500651_0017643 3300053093 Bacteria 4409
171 Ga0500594_0005235 3300053118 Bacteria 2873
172 Ga0500608_000048 3300053122 Bacteria 55108
173 Ga0500608_000371 3300053122 Bacteria 17456
174 Ga0500658_0015924 3300053134 Bacteria 2797
175 Ga0500573_0050161 3300053140 Bacteria 2401
176 Ga0500573_0113777 3300053140 Bacteria 1512
177 Ga0500616_0032365 3300053153 Bacteria 2859
178 Ga0500622_0234155 3300053156 Bacteria 815
179 Ga0500627_0085887 3300053158 Bacteria 1405
180 Ga0500645_001241 3300053730 Bacteria 13445
181 Ga0466962_0003245 3300061719 Bacteria 7730
182 Ga0530510_0068792 3300061734 Bacteria 2569
183 Ga0530510_0080904 3300061734 Bacteria 2365
184 2643884279 2643221574 Bacteria 2789653
185 2644354571 2643221663 Bacteria 3425771
186 2644549540 2643221699 Bacteria 5731501
187 2644552332 2643221699 Bacteria 5731501
188 2837679778 2837678835 Bacteria 5252418
189 2840879184 2840878972 Bacteria 5483153
190 2854685444 2854681122 Bacteria 4548679
191 2919681505 2919679072 Bacteria 4629602
192 2928972678 2928972540 Bacteria 3058286
193 2941488722 2941485952 Bacteria 3591484
194 2977242458 2977240413 Bacteria 3191065
195 3000405649 3000405567 Bacteria 3779330
196 8045867451 8045864390 Bacteria 5043873
197 Ga0500644_0002048
198 rootH1_10173474
199 Ga0055536_1003623
200 Ga0055531_10021610
201 Ga0070658_10744488
202 Ga0070670_100461559
203 Ga0070677_10209175
204 Ga0070668_100050537
205 Ga0070659_100090374
206 Ga0070714_100037079
207 Ga0068867_100946334
208 Ga0068867_101225625
209 Ga0068853_100269009
210 Ga0070686_100062043
211 Ga0070664_100108428
212 Ga0068856_100044623
213 Ga0068859_100706027
214 Ga0068863_100081183
215 Ga0068863_100347955
216 Ga0068862_100088968
217 Ga0068862_100144273
218 Ga0070716_100375409
219 Ga0075434_101526143
220 Ga0097620_100706015
221 Ga0114129_10340545
222 Ga0105248_11973691
223 Ga0105249_10219301
224 Ga0105249_10292009
225 Ga0105246_11225807
226 Ga0157371_10006560
227 Ga0157370_10255894
228 Ga0157369_10014643
229 Ga0157375_11287116
230 Ga0157380_11934133
231 Ga0183365_10001
232 Ga0183360_10489
233 Ga0163161_10227108
234 Ga0213876_10158812
235 Ga0213875_10008890
236 Ga0209676_1000890
237 Ga0209050_1069074
238 Ga0209257_1000060
239 Ga0207650_10185535
240 Ga0207650_10714763
241 Ga0207664_10204582
242 Ga0207669_10662620
243 Ga0207679_10078444
244 Ga0207668_10071912
245 Ga0207639_10045922
246 Ga0207641_10532323
247 Ga0207648_11266081
248 Ga0207674_10401258
249 Ga0268266_10928260
250 Ga0268265_10522049
251 Ga0268264_10247619
252 Ga0265337_1005839
253 Ga0265338_10067121
254 Ga0265327_10000140
255 Ga0307408_100797914
256 Ga0316576_10414578
257 Ga0316578_10387471
258 Ga0307413_10255389
259 Ga0307406_10000294
260 Ga0307414_10026115
261 Ga0307414_10306668
262 Ga0307414_10334752
263 Ga0307414_10343555
264 Ga0307414_10901714
265 Ga0373935_0516459
266 Ga0373927_0010656
267 Ga0373925_0110099
268 Ga0395899_0109533
269 Ga0395905_0043821
270 Ga0436364_0735311
271 Ga0400483_045037
272 Ga0400483_102634
273 Ga0400483_130326
274 Ga0400483_142605
275 Ga0400483_171692
276 Ga0436365_0189939
277 Ga0436360_1227585
278 Ga0436361_0300225
279 Ga0436361_0418506
280 Ga0436362_1155349
281 Ga0451802_0486427
282 Ga0451843_0621948
283 Ga0466969_0000832
284 Ga0466972_0062570
285 Ga0466965_0374416
286 Ga0466966_0019246
287 Ga0466961_0001151
288 Ga0466961_0011815
289 Ga0466971_0000569
290 Ga0466971_0034829
291 Ga0466970_0008470
292 Ga0466960_0252993
293 Ga0466959_0000072
294 Ga0466958_0022861
295 Ga0495638_0047369
296 Ga0495638_0052260
297 Ga0495580_0490512
298 Ga0495585_0131486
299 Ga0495585_0138875
300 Ga0495610_0000360
301 Ga0495610_0011721
302 Ga0495616_0029159
303 Ga0495620_0009084
304 Ga0495643_0065105
305 Ga0495643_0202584
306 Ga0495648_0014778
307 Ga0495654_0000082
308 Ga0495633_0001025
309 Ga0495625_0001183
310 Ga0495625_0004949
311 Ga0495625_0008183
312 Ga0495671_0102690
313 Ga0495649_0011042
314 Ga0495660_0041538
315 Ga0495681_0098990
316 Ga0495686_0007790
317 Ga0496106_0197212
318 Ga0496115_0675973
319 Ga0496122_0075059
320 Ga0496123_0000512
321 Ga0496124_0419494
322 Ga0496125_0002197
323 Ga0496126_0401818
324 Ga0495678_001567
325 Ga0501031_0595181
326 Ga0501033_0009299
327 Ga0501033_0191011
328 Ga0501034_0003497
329 Ga0501034_0047209
330 Ga0501034_1270437
331 Ga0501037_0230193
332 Ga0501037_0601117
333 Ga0501038_0326239
334 Ga0501039_0256138
335 Ga0501040_0117797
336 Ga0501042_0043346
337 Ga0501042_0223416
338 Ga0501042_0492691
339 Ga0501043_0122578
340 Ga0501043_0123698
341 Ga0501048_0457178
342 Ga0501068_0094120
343 Ga0501070_0342952
344 Ga0501071_0017016
345 Ga0501071_0049707
346 Ga0501075_0073816
347 Ga0501075_0267888
348 Ga0501075_0740984
349 Ga0501238_024673
350 Ga0501079_0063873
351 Ga0501080_0338756
352 Ga0501080_0795629
353 Ga0501083_0107695
354 Ga0501035_0053549
355 Ga0501035_0071654
356 Ga0501035_0487059
357 Ga0501035_0989797
358 Ga0501035_1115550
359 Ga0501044_0001671
360 Ga0501044_0610064
361 Ga0501045_0081419
362 nmdc:mga05p37_84449_c1
363 nmdc:mga08y16_707618_c1
364 nmdc:mga0n895_1008306_c1
365 Ga0500635_0000422
366 Ga0500651_0017643
367 Ga0500594_0005235
368 Ga0500608_000048
369 Ga0500608_000371
370 Ga0500658_0015924
371 Ga0500573_0050161
372 Ga0500573_0113777
373 Ga0500616_0032365
374 Ga0500622_0234155
375 Ga0500627_0085887
376 Ga0500645_001241
377 Ga0466962_0003245
378 Ga0530510_0068792
379 Ga0530510_0080904
380 2643884279
381 2644354571
382 2644549540
383 2644552332
384 2837679778
385 2840879184
386 2854685444
387 2919681505
388 2928972678
389 2941488722
390 2977242458
391 3000405649
392 8045867451

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

159

214

0.99

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

32

89

0.98

PF01132

EFP

Elongation factor P (EF-P) OB domain

97

151

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wxk-assembly1.cif.gz_B earp bound with domain i of ef-p 0.8965 3 62
3oyy-assembly1.cif.gz_A structure of pseudomonas aeruginosa elongation factor p 0.8703 1 184
3oyy-assembly1.cif.gz_A structure of pseudomonas aeruginosa elongation factor p 0.8616 1 184
3a5z-assembly1.cif.gz_B crystal structure of escherichia coli genx in complex with elongation factor p 0.8423 4 126
1yby-assembly1.cif.gz_A conserved hypothetical protein cth-95 from clostridium thermocellum 0.8356 3 184
ID Description Score Start End Superfamily
af_P9WNM3_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9711 62 125 2.40.50.140
af_Q557H6_34_95_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9676 3 61 2.30.30.30
af_Q2FY41_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9628 62 125 2.40.50.140
af_P9WNM3_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9564 62 125 2.40.50.140
5j3bA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9532 128 184 2.40.50.140
ID Description Score Start End GO Terms
AF-X6EXY4-F1-model_v4 Elongation factor P 0.9721 80 185 GO:0003746
GO:0005737
GO:0043043
AF-A0A2W6XYJ0-F1-model_v4 Elongation factor P 0.9563 64 185 GO:0003746
GO:0005737
GO:0043043
AF-X6EXY4-F1-model_v4 Elongation factor P 0.9542 80 185 GO:0003746
GO:0005737
GO:0043043
AF-A0A6N2DY01-F1-model_v4 Elongation factor P 0.9515 82 185 GO:0003746
GO:0005737
GO:0043043
AF-A0A659UJW2-F1-model_v4 Elongation factor P 0.95 95 185 GO:0003746
GO:0005737
GO:0043043

Map