F302180

General Info

Members Datasets Scaffolds Average Seq Length
196 120 196 151

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_1000471|Ga0501080_1000471_115_639
Length 174
Sequence MDFRRRRPTISGLDMEGTMPDFATTDLLYAIVHHVLVFALAGVIAYEFAVVCPSMTAADILRVGKVDMWYGLLAGLILIVGFARAVYAAKGWAYYSHNHFFWAKIGTFALVGILSLWPTIQFIRWRGELKNDQSAMPSAGAIAAARRFIWLEAILFALIPVFAAAMARGYGEVS

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
35 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
36 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
39 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
56 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
62 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
82 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
83 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
84 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
100 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
117 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
118 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
119 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
120 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 3.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.55
Nodule 0
Rhizoplane 1.02
Rhizosphere 88.27
Stem 0
Stem Tuber 0
Unclassified 8.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10193965 3300003316 Unclassified 1269
2 rootH2_10139148 3300003320 Bacteria 4760
3 Ga0070658_10057895 3300005327 Unclassified 3153
4 Ga0070658_10074217 3300005327 Bacteria 2789
5 Ga0070666_10076504 3300005335 Bacteria 2283
6 Ga0070680_100000201 3300005336 Bacteria 38933
7 Ga0070682_101187520 3300005337 Bacteria 643
8 Ga0070660_100004202 3300005339 Bacteria 9945
9 Ga0070660_100808369 3300005339 Bacteria 789
10 Ga0070691_10006942 3300005341 Bacteria 5183
11 Ga0070661_100921328 3300005344 Bacteria 722
12 Ga0070659_100054564 3300005366 Bacteria 3148
13 Ga0070663_101715083 3300005455 Bacteria 562
14 Ga0070681_10000005 3300005458 Bacteria 183053
15 Ga0070679_100000293 3300005530 Bacteria 42433
16 Ga0070679_100003462 3300005530 Bacteria 14454
17 Ga0070679_101143370 3300005530 Bacteria 723
18 Ga0068853_100001311 3300005539 Bacteria 17870
19 Ga0070665_100308045 3300005548 Bacteria 1587
20 Ga0068855_100114613 3300005563 Bacteria 3090
21 Ga0068855_100134170 3300005563 Bacteria 2825
22 Ga0068855_100203856 3300005563 Bacteria 2226
23 Ga0068854_100059083 3300005578 Unclassified 2770
24 Ga0068854_100819349 3300005578 Bacteria 813
25 Ga0068856_100204961 3300005614 Bacteria 1987
26 Ga0068863_100163854 3300005841 Bacteria 2131
27 Ga0068863_100574653 3300005841 Bacteria 1114
28 Ga0070717_10129293 3300006028 Bacteria 2171
29 Ga0068865_100010431 3300006881 Bacteria 5783
30 Ga0068865_100619179 3300006881 Bacteria 917
31 Ga0105240_10070950 3300009093 Bacteria 4308
32 Ga0105240_10073611 3300009093 Bacteria 4218
33 Ga0105240_10168353 3300009093 Bacteria 2597
34 Ga0105240_10266149 3300009093 Bacteria 1976
35 Ga0105240_10798098 3300009093 Bacteria 1023
36 Ga0105240_11393235 3300009093 Bacteria 737
37 Ga0105240_11698305 3300009093 Bacteria 659
38 Ga0105245_11121775 3300009098 Bacteria 833
39 Ga0105245_11159643 3300009098 Bacteria 820
40 Ga0105245_11711914 3300009098 Bacteria 681
41 Ga0105241_10186021 3300009174 Bacteria 1726
42 Ga0105241_10217653 3300009174 Bacteria 1603
43 Ga0105241_10248355 3300009174 Bacteria 1507
44 Ga0105241_10248670 3300009174 Unclassified 1506
45 Ga0105248_10000001 3300009177 Bacteria 1881304
46 Ga0105248_10000154 3300009177 Bacteria 80081
47 Ga0105248_10451483 3300009177 Bacteria 1448
48 Ga0105238_10006632 3300009551 Bacteria 11541
49 Ga0105238_10748082 3300009551 Unclassified 991
50 Ga0105238_11081685 3300009551 Bacteria 824
51 Ga0105238_11725476 3300009551 Bacteria 657
52 Ga0105239_10094576 3300010375 Bacteria 3301
53 Ga0157373_10027620 3300013100 Unclassified 4094
54 Ga0157371_10104160 3300013102 Unclassified 2013
55 Ga0157370_10074608 3300013104 Unclassified 3199
56 Ga0157370_10183318 3300013104 Bacteria 1945
57 Ga0163162_10220675 3300013306 Bacteria 2026
58 Ga0163162_11541089 3300013306 Bacteria 757
59 Ga0157372_11122188 3300013307 Bacteria 909
60 Ga0163163_10281069 3300014325 Bacteria 1716
61 Ga0213873_10017676 3300021358 Bacteria 1630
62 Ga0213872_10036087 3300021361 Bacteria 2260
63 Ga0213874_10000805 3300021377 Bacteria 6391
64 Ga0213874_10058389 3300021377 Bacteria 1202
65 Ga0213876_10063471 3300021384 Bacteria 1950
66 Ga0213876_10192284 3300021384 Bacteria 1085
67 Ga0213871_10284671 3300021441 Unclassified 531
68 Ga0207680_10002850 3300025903 Bacteria 8091
69 Ga0207705_10001005 3300025909 Bacteria 22914
70 Ga0207705_10821891 3300025909 Bacteria 721
71 Ga0207654_10035319 3300025911 Bacteria 2784
72 Ga0207654_10163366 3300025911 Bacteria 1440
73 Ga0207654_10436528 3300025911 Bacteria 916
74 Ga0207707_10000005 3300025912 Bacteria 382024
75 Ga0207707_10004882 3300025912 Bacteria 11776
76 Ga0207707_10013828 3300025912 Bacteria 7038
77 Ga0207695_10001229 3300025913 Bacteria 43850
78 Ga0207695_10127406 3300025913 Bacteria 2506
79 Ga0207695_10155197 3300025913 Bacteria 2224
80 Ga0207695_10320813 3300025913 Bacteria 1439
81 Ga0207695_10792918 3300025913 Bacteria 827
82 Ga0207695_11390871 3300025913 Unclassified 582
83 Ga0207695_11552457 3300025913 Bacteria 542
84 Ga0207660_10000507 3300025917 Bacteria 26030
85 Ga0207660_10006456 3300025917 Bacteria 7604
86 Ga0207660_10172450 3300025917 Bacteria 1675
87 Ga0207657_10000543 3300025919 Bacteria 40303
88 Ga0207652_10000320 3300025921 Bacteria 49730
89 Ga0207652_10001196 3300025921 Bacteria 23351
90 Ga0207652_10024709 3300025921 Bacteria 4987
91 Ga0207694_10113731 3300025924 Bacteria 2155
92 Ga0207694_10159951 3300025924 Bacteria 1818
93 Ga0207690_11024351 3300025932 Bacteria 687
94 Ga0207704_10000400 3300025938 Bacteria 19733
95 Ga0207704_10090691 3300025938 Bacteria 2007
96 Ga0207711_10000002 3300025941 Bacteria 1228676
97 Ga0207711_10000887 3300025941 Bacteria 28843
98 Ga0207711_10217907 3300025941 Bacteria 1745
99 Ga0207711_10505545 3300025941 Bacteria 1126
100 Ga0207640_10183486 3300025981 Bacteria 1571
101 Ga0207639_10002815 3300026041 Bacteria 11672
102 Ga0207641_10146830 3300026088 Bacteria 2133
103 Ga0207698_10025402 3300026142 Bacteria 4173
104 Ga0265354_1001237 3300028016 Bacteria 3850
105 Ga0265356_1000600 3300028017 Bacteria 6330
106 Ga0268266_10074761 3300028379 Bacteria 2942
107 Ga0268266_10509758 3300028379 Bacteria 1149
108 Ga0265337_1042603 3300028556 Bacteria 1301
109 Ga0265334_10059643 3300028573 Bacteria 1441
110 Ga0265338_10000006 3300028800 Bacteria 570804
111 Ga0265338_10025575 3300028800 Bacteria 5986
112 Ga0265338_10035689 3300028800 Bacteria 4771
113 Ga0265338_10169466 3300028800 Bacteria 1677
114 Ga0265338_10349164 3300028800 Bacteria 1064
115 Ga0265324_10167720 3300029957 Unclassified 746
116 Ga0265762_1022542 3300030760 Bacteria 1164
117 Ga0265770_1000022 3300030878 Bacteria 15358
118 Ga0265771_1001440 3300031010 Unclassified 1128
119 Ga0265760_10008765 3300031090 Bacteria 2891
120 Ga0265760_10018329 3300031090 Bacteria 2015
121 Ga0265760_10148699 3300031090 Unclassified 767
122 Ga0265332_10132631 3300031238 Unclassified 1045
123 Ga0265328_10278312 3300031239 Unclassified 644
124 Ga0265320_10000949 3300031240 Bacteria 21596
125 Ga0265325_10000007 3300031241 Bacteria 208874
126 Ga0265325_10037513 3300031241 Bacteria 2562
127 Ga0265329_10010499 3300031242 Bacteria 3395
128 Ga0265340_10025018 3300031247 Unclassified 3027
129 Ga0265339_10000929 3300031249 Bacteria 22495
130 Ga0265339_10021867 3300031249 Bacteria 3713
131 Ga0265339_10024772 3300031249 Bacteria 3453
132 Ga0265331_10013240 3300031250 Bacteria 4443
133 Ga0265331_10064134 3300031250 Unclassified 1730
134 Ga0265316_10744910 3300031344 Bacteria 689
135 Ga0307513_10022718 3300031456 Bacteria 7360
136 Ga0265313_10054795 3300031595 Bacteria 1892
137 Ga0265313_10057582 3300031595 Bacteria 1834
138 Ga0265313_10227369 3300031595 Bacteria 767
139 Ga0265314_10004456 3300031711 Bacteria 12996
140 Ga0265314_10055688 3300031711 Bacteria 2727
141 Ga0265314_10189731 3300031711 Unclassified 1224
142 Ga0265342_10013794 3300031712 Bacteria 5396
143 Ga0265342_10060548 3300031712 Bacteria 2232
144 Ga0265342_10130329 3300031712 Unclassified 1410
145 Ga0307516_10000131 3300031730 Bacteria 89180
146 Ga0307510_10401359 3300033180 Bacteria 814
147 Ga0316214_1026232 3300033545 Unclassified 821
148 Ga0373939_0115485 3300035114 Bacteria 940
149 Ga0373946_0225824 3300035171 Unclassified 906
150 Ga0373955_0875177 3300035172 Unclassified 553
151 Ga0373927_0242709 3300035695 Unclassified 1184
152 Ga0373927_0307660 3300035695 Unclassified 1043
153 Ga0373937_1152486 3300036401 Unclassified 724
154 Ga0373925_0174554 3300037068 Unclassified 1698
155 Ga0373925_0497235 3300037068 Bacteria 1001
156 Ga0395905_0411455 3300037471 Bacteria 1248
157 Ga0436364_0239839 3300037853 Bacteria 3016
158 Ga0436365_1082332 3300039437 Unclassified 4385
159 Ga0436365_1102840 3300039437 Bacteria 4165
160 Ga0436360_0165882 3300039438 Unclassified 568
161 Ga0436361_0531564 3300039447 Bacteria 3274
162 Ga0436361_0757257 3300039447 Bacteria 797
163 Ga0436363_0734760 3300039450 Bacteria 6863
164 Ga0436363_1101874 3300039450 Bacteria 38864
165 Ga0436362_0349359 3300039453 Unclassified 1022
166 Ga0436362_0717659 3300039453 Bacteria 5447
167 Ga0466959_0198966 3300045049 Bacteria 1396
168 Ga0495580_0354822 3300046472 Bacteria 993
169 Ga0495584_0065120 3300046491 Bacteria 1833
170 Ga0495585_0365466 3300046492 Bacteria 699
171 Ga0495642_0044877 3300046528 Bacteria 1805
172 Ga0495622_0018164 3300046557 Bacteria 3275
173 Ga0495658_0249218 3300046683 Bacteria 1117
174 Ga0495672_0025971 3300047320 Bacteria 3743
175 Ga0495683_0057400 3300047323 Bacteria 1935
176 Ga0495602_0087794 3300048088 Unclassified 2591
177 Ga0495626_0180476 3300048091 Bacteria 875
178 Ga0496106_0394080 3300048909 Bacteria 1113
179 Ga0496115_0300151 3300048918 Bacteria 1316
180 Ga0496121_0647862 3300048924 Bacteria 644
181 Ga0501031_0041946 3300049568 Bacteria 2988
182 Ga0501032_0067998 3300049569 Bacteria 2379
183 Ga0501037_0064828 3300049573 Bacteria 2662
184 Ga0501070_0000110 3300049586 Bacteria 72071
185 Ga0501070_0107970 3300049586 Bacteria 2300
186 Ga0501080_0003670 3300049742 Bacteria 13546
187 Ga0501080_0005131 3300049742 Bacteria 11667
188 Ga0501080_1000471 3300049742 Bacteria 725
189 Ga0501035_0001524 3300049822 Bacteria 23664
190 Ga0501044_0001134 3300049823 Bacteria 31657
191 Ga0501044_0247103 3300049823 Unclassified 1727
192 Ga0500646_0009138 3300053090 Bacteria 2537
193 Ga0500595_027867 3300053119 Bacteria 1930
194 Ga0500619_000520 3300053154 Bacteria 6660
195 Ga0500622_0003785 3300053156 Bacteria 9867
196 Ga0500637_0027643 3300053178 Bacteria 3132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031730 Ga0307516_10000131 Ga0307516_1000013160 121
2 3300035172 Ga0373955_0875177 Ga0373955_0875177_17_394 125
3 3300028800 Ga0265338_10169466 Ga0265338_101694663 130
4 3300021377 Ga0213874_10000805 Ga0213874_100008055 140
5 3300039450 Ga0436363_1101874 Ga0436363_1101874_27982_28455 140
6 3300048088 Ga0495602_0087794 Ga0495602_0087794_1129_1569 140
7 3300005335 Ga0070666_10076504 Ga0070666_100765041 143
8 3300005548 Ga0070665_100308045 Ga0070665_1003080452 143
9 3300005563 Ga0068855_100203856 Ga0068855_1002038561 143
10 3300025903 Ga0207680_10002850 Ga0207680_100028505 143
11 3300025911 Ga0207654_10436528 Ga0207654_104365282 143
12 3300028016 Ga0265354_1001237 Ga0265354_10012374 145
13 3300028017 Ga0265356_1000600 Ga0265356_10006001 145
14 3300028556 Ga0265337_1042603 Ga0265337_10426031 145
15 3300028800 Ga0265338_10035689 Ga0265338_100356891 145
16 3300029957 Ga0265324_10167720 Ga0265324_101677201 145
17 3300030760 Ga0265762_1022542 Ga0265762_10225422 145
18 3300030878 Ga0265770_1000022 Ga0265770_100002212 145
19 3300031090 Ga0265760_10008765 Ga0265760_100087651 145
20 3300031090 Ga0265760_10018329 Ga0265760_100183292 145
21 3300031456 Ga0307513_10022718 Ga0307513_100227184 145
22 3300033180 Ga0307510_10401359 Ga0307510_104013592 145
23 3300033545 Ga0316214_1026232 Ga0316214_10262321 145
24 3300037471 Ga0395905_0411455 Ga0395905_0411455_238_675 145
25 3300039447 Ga0436361_0757257 Ga0436361_0757257_305_742 145
26 3300046472 Ga0495580_0354822 Ga0495580_0354822_53_490 145
27 3300048909 Ga0496106_0394080 Ga0496106_0394080_517_954 145
28 3300048924 Ga0496121_0647862 Ga0496121_0647862_24_461 145
29 3300053156 Ga0500622_0003785 Ga0500622_0003785_8368_8805 145
30 3300005327 Ga0070658_10057895 Ga0070658_100578952 146
31 3300005337 Ga0070682_101187520 Ga0070682_1011875201 146
32 3300005339 Ga0070660_100808369 Ga0070660_1008083691 146
33 3300005341 Ga0070691_10006942 Ga0070691_100069428 146
34 3300005530 Ga0070679_100003462 Ga0070679_10000346213 146
35 3300005563 Ga0068855_100114613 Ga0068855_1001146135 146
36 3300005578 Ga0068854_100819349 Ga0068854_1008193492 146
37 3300005614 Ga0068856_100204961 Ga0068856_1002049612 146
38 3300005841 Ga0068863_100574653 Ga0068863_1005746531 146
39 3300006028 Ga0070717_10129293 Ga0070717_101292932 146
40 3300006881 Ga0068865_100010431 Ga0068865_1000104315 146
41 3300006881 Ga0068865_100619179 Ga0068865_1006191792 146
42 3300009093 Ga0105240_10070950 Ga0105240_100709502 146
43 3300009093 Ga0105240_10073611 Ga0105240_100736112 146
44 3300009093 Ga0105240_10168353 Ga0105240_101683532 146
45 3300009093 Ga0105240_10798098 Ga0105240_107980982 146
46 3300009093 Ga0105240_11393235 Ga0105240_113932352 146
47 3300009093 Ga0105240_11698305 Ga0105240_116983052 146
48 3300009098 Ga0105245_11121775 Ga0105245_111217751 146
49 3300009098 Ga0105245_11159643 Ga0105245_111596431 146
50 3300009174 Ga0105241_10186021 Ga0105241_101860212 146
51 3300009174 Ga0105241_10248670 Ga0105241_102486702 146
52 3300009177 Ga0105248_10000154 Ga0105248_1000015475 146
53 3300009177 Ga0105248_10451483 Ga0105248_104514833 146
54 3300009551 Ga0105238_10748082 Ga0105238_107480822 146
55 3300009551 Ga0105238_11081685 Ga0105238_110816852 146
56 3300013104 Ga0157370_10183318 Ga0157370_101833183 146
57 3300013306 Ga0163162_10220675 Ga0163162_102206753 146
58 3300013306 Ga0163162_11541089 Ga0163162_115410891 146
59 3300025911 Ga0207654_10035319 Ga0207654_100353192 146
60 3300025912 Ga0207707_10013828 Ga0207707_100138288 146
61 3300025913 Ga0207695_10001229 Ga0207695_1000122944 146
62 3300025913 Ga0207695_10127406 Ga0207695_101274062 146
63 3300025913 Ga0207695_10320813 Ga0207695_103208132 146
64 3300025913 Ga0207695_10792918 Ga0207695_107929181 146
65 3300025913 Ga0207695_11390871 Ga0207695_113908712 146
66 3300025913 Ga0207695_11552457 Ga0207695_115524571 146
67 3300025917 Ga0207660_10172450 Ga0207660_101724502 146
68 3300025921 Ga0207652_10024709 Ga0207652_100247094 146
69 3300025924 Ga0207694_10159951 Ga0207694_101599514 146
70 3300025938 Ga0207704_10000400 Ga0207704_1000040013 146
71 3300025938 Ga0207704_10090691 Ga0207704_100906912 146
72 3300025941 Ga0207711_10000887 Ga0207711_1000088727 146
73 3300025941 Ga0207711_10505545 Ga0207711_105055452 146
74 3300025981 Ga0207640_10183486 Ga0207640_101834862 146
75 3300028379 Ga0268266_10074761 Ga0268266_100747612 146
76 3300028379 Ga0268266_10509758 Ga0268266_105097582 146
77 3300031239 Ga0265328_10278312 Ga0265328_102783122 146
78 3300031249 Ga0265339_10021867 Ga0265339_100218673 146
79 3300031250 Ga0265331_10064134 Ga0265331_100641342 146
80 3300031711 Ga0265314_10189731 Ga0265314_101897312 146
81 3300031712 Ga0265342_10130329 Ga0265342_101303292 146
82 3300048918 Ga0496115_0300151 Ga0496115_0300151_527_970 146
83 3300021384 Ga0213876_10192284 Ga0213876_101922841 147
84 3300035171 Ga0373946_0225824 Ga0373946_0225824_448_891 147
85 3300035695 Ga0373927_0242709 Ga0373927_0242709_410_853 147
86 3300037068 Ga0373925_0174554 Ga0373925_0174554_792_1235 147
87 3300039437 Ga0436365_1102840 Ga0436365_1102840_626_1069 147
88 3300045049 Ga0466959_0198966 Ga0466959_0198966_865_1308 147
89 3300021358 Ga0213873_10017676 Ga0213873_100176761 148
90 3300021384 Ga0213876_10063471 Ga0213876_100634712 148
91 3300037853 Ga0436364_0239839 Ga0436364_0239839_2148_2594 148
92 3300039437 Ga0436365_1082332 Ga0436365_1082332_1685_2131 148
93 3300039453 Ga0436362_0717659 Ga0436362_0717659_3956_4402 148
94 3300021361 Ga0213872_10036087 Ga0213872_100360872 149
95 3300021441 Ga0213871_10284671 Ga0213871_102846711 149
96 3300031010 Ga0265771_1001440 Ga0265771_10014402 149
97 3300031090 Ga0265760_10148699 Ga0265760_101486992 149
98 3300039438 Ga0436360_0165882 Ga0436360_0165882_49_498 149
99 3300039447 Ga0436361_0531564 Ga0436361_0531564_1940_2389 149
100 3300014325 Ga0163163_10281069 Ga0163163_102810692 150
101 3300036401 Ga0373937_1152486 Ga0373937_1152486_162_617 151
102 3300053119 Ga0500595_027867 Ga0500595_027867_1318_1779 153
103 3300003320 rootH2_10139148 rootH2_101391487 154
104 3300003316 rootH1_10193965 rootH1_101939651 155
105 3300005327 Ga0070658_10074217 Ga0070658_100742174 155
106 3300005336 Ga0070680_100000201 Ga0070680_10000020119 155
107 3300005339 Ga0070660_100004202 Ga0070660_1000042025 155
108 3300005344 Ga0070661_100921328 Ga0070661_1009213281 155
109 3300005366 Ga0070659_100054564 Ga0070659_1000545642 155
110 3300005455 Ga0070663_101715083 Ga0070663_1017150831 155
111 3300005458 Ga0070681_10000005 Ga0070681_10000005113 155
112 3300005530 Ga0070679_100000293 Ga0070679_10000029328 155
113 3300005530 Ga0070679_101143370 Ga0070679_1011433701 155
114 3300005539 Ga0068853_100001311 Ga0068853_10000131116 155
115 3300005563 Ga0068855_100134170 Ga0068855_1001341706 155
116 3300005578 Ga0068854_100059083 Ga0068854_1000590832 155
117 3300005841 Ga0068863_100163854 Ga0068863_1001638542 155
118 3300009093 Ga0105240_10266149 Ga0105240_102661492 155
119 3300009098 Ga0105245_11711914 Ga0105245_117119141 155
120 3300009174 Ga0105241_10217653 Ga0105241_102176532 155
121 3300009174 Ga0105241_10248355 Ga0105241_102483551 155
122 3300009177 Ga0105248_10000001 Ga0105248_10000001218 155
123 3300009551 Ga0105238_10006632 Ga0105238_100066324 155
124 3300009551 Ga0105238_11725476 Ga0105238_117254761 155
125 3300010375 Ga0105239_10094576 Ga0105239_100945764 155
126 3300013100 Ga0157373_10027620 Ga0157373_100276206 155
127 3300013102 Ga0157371_10104160 Ga0157371_101041604 155
128 3300013104 Ga0157370_10074608 Ga0157370_100746085 155
129 3300013307 Ga0157372_11122188 Ga0157372_111221881 155
130 3300021377 Ga0213874_10058389 Ga0213874_100583892 155
131 3300025909 Ga0207705_10001005 Ga0207705_1000100513 155
132 3300025909 Ga0207705_10821891 Ga0207705_108218911 155
133 3300025911 Ga0207654_10163366 Ga0207654_101633662 155
134 3300025912 Ga0207707_10000005 Ga0207707_10000005270 155
135 3300025912 Ga0207707_10004882 Ga0207707_1000488214 155
136 3300025913 Ga0207695_10155197 Ga0207695_101551972 155
137 3300025917 Ga0207660_10000507 Ga0207660_100005075 155
138 3300025917 Ga0207660_10006456 Ga0207660_100064568 155
139 3300025919 Ga0207657_10000543 Ga0207657_1000054336 155
140 3300025921 Ga0207652_10000320 Ga0207652_1000032025 155
141 3300025921 Ga0207652_10001196 Ga0207652_1000119625 155
142 3300025924 Ga0207694_10113731 Ga0207694_101137312 155
143 3300025932 Ga0207690_11024351 Ga0207690_110243511 155
144 3300025941 Ga0207711_10000002 Ga0207711_10000002919 155
145 3300025941 Ga0207711_10217907 Ga0207711_102179072 155
146 3300026041 Ga0207639_10002815 Ga0207639_100028155 155
147 3300026088 Ga0207641_10146830 Ga0207641_101468302 155
148 3300026142 Ga0207698_10025402 Ga0207698_100254026 155
149 3300028573 Ga0265334_10059643 Ga0265334_100596432 155
150 3300028800 Ga0265338_10000006 Ga0265338_1000000623 155
151 3300028800 Ga0265338_10025575 Ga0265338_100255754 155
152 3300028800 Ga0265338_10349164 Ga0265338_103491642 155
153 3300031238 Ga0265332_10132631 Ga0265332_101326312 155
154 3300031240 Ga0265320_10000949 Ga0265320_100009492 155
155 3300031241 Ga0265325_10000007 Ga0265325_1000000723 155
156 3300031241 Ga0265325_10037513 Ga0265325_100375133 155
157 3300031242 Ga0265329_10010499 Ga0265329_100104992 155
158 3300031247 Ga0265340_10025018 Ga0265340_100250186 155
159 3300031249 Ga0265339_10000929 Ga0265339_1000092928 155
160 3300031249 Ga0265339_10024772 Ga0265339_100247723 155
161 3300031250 Ga0265331_10013240 Ga0265331_100132403 155
162 3300031344 Ga0265316_10744910 Ga0265316_107449102 155
163 3300031595 Ga0265313_10054795 Ga0265313_100547952 155
164 3300031595 Ga0265313_10057582 Ga0265313_100575823 155
165 3300031595 Ga0265313_10227369 Ga0265313_102273692 155
166 3300031711 Ga0265314_10004456 Ga0265314_1000445614 155
167 3300031711 Ga0265314_10055688 Ga0265314_100556883 155
168 3300031712 Ga0265342_10013794 Ga0265342_100137942 155
169 3300031712 Ga0265342_10060548 Ga0265342_100605482 155
170 3300035114 Ga0373939_0115485 Ga0373939_0115485_177_647 155
171 3300035695 Ga0373927_0307660 Ga0373927_0307660_202_675 155
172 3300037068 Ga0373925_0497235 Ga0373925_0497235_371_841 155
173 3300039450 Ga0436363_0734760 Ga0436363_0734760_2746_3219 155
174 3300039453 Ga0436362_0349359 Ga0436362_0349359_131_604 155
175 3300046491 Ga0495584_0065120 Ga0495584_0065120_984_1454 155
176 3300046492 Ga0495585_0365466 Ga0495585_0365466_100_570 155
177 3300046528 Ga0495642_0044877 Ga0495642_0044877_879_1349 155
178 3300046557 Ga0495622_0018164 Ga0495622_0018164_2455_2925 155
179 3300046683 Ga0495658_0249218 Ga0495658_0249218_158_628 155
180 3300047320 Ga0495672_0025971 Ga0495672_0025971_714_1184 155
181 3300047323 Ga0495683_0057400 Ga0495683_0057400_1224_1694 155
182 3300048091 Ga0495626_0180476 Ga0495626_0180476_51_521 155
183 3300049568 Ga0501031_0041946 Ga0501031_0041946_1185_1652 155
184 3300049569 Ga0501032_0067998 Ga0501032_0067998_1571_2038 155
185 3300049573 Ga0501037_0064828 Ga0501037_0064828_908_1375 155
186 3300049586 Ga0501070_0000110 Ga0501070_0000110_15682_16149 155
187 3300049586 Ga0501070_0107970 Ga0501070_0107970_743_1210 155
188 3300049742 Ga0501080_0003670 Ga0501080_0003670_1175_1642 155
189 3300049742 Ga0501080_0005131 Ga0501080_0005131_2284_2781 155
190 3300049742 Ga0501080_1000471 Ga0501080_1000471_115_639 155
191 3300049822 Ga0501035_0001524 Ga0501035_0001524_3131_3598 155
192 3300049823 Ga0501044_0001134 Ga0501044_0001134_15507_15974 155
193 3300049823 Ga0501044_0247103 Ga0501044_0247103_460_927 155
194 3300053090 Ga0500646_0009138 Ga0500646_0009138_255_725 155
195 3300053154 Ga0500619_000520 Ga0500619_000520_842_1309 155
196 3300053178 Ga0500637_0027643 Ga0500637_0027643_2413_2883 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09980

DUF2214

Predicted membrane protein (DUF2214)

25

171

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k05-assembly1.cif.gz_A crystal structure of the focal adhesion targeting domain of focal adhesion kinase 0.6884 13 155
4e17-assembly1.cif.gz_A alpha-e-catenin is an autoinhibited molecule that co-activates vinculin 0.688 4 143
6bfi-assembly2.cif.gz_B vinculin homolog in a sponge (phylum porifera) reveals vertebrate-like cell adhesions involved in early multicellular evolution 0.687 14 145
4e18-assembly1.cif.gz_A alpha-e-catenin is an autoinhibited molecule that co-activates vinculin 0.6776 4 143
6xz4-assembly1.cif.gz_B crystal structure of tlnrd1 0.6738 17 144
ID Description Score Start End Superfamily
4hkaA01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8282 8 67 1.20.58.480
af_G5EGK1_1860_1981_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.7601 10 143 1.20.120.230
af_G5EGK1_1860_1981_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.7178 10 143 1.20.120.230
4e17A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.7059 14 143 1.20.120.230
af_A0A2R9YJG7_640_756_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6919 16 143 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A525K5Z5-F1-model_v4 DUF2214 family protein 0.9918 7 155 GO:0016020
AF-A0A1W9J1X3-F1-model_v4 DUF2214 domain-containing protein 0.9871 6 152 GO:0016020
AF-J3A7A2-F1-model_v4 Putative membrane protein 0.9865 7 152 GO:0016020
AF-A0A2S5TWJ0-F1-model_v4 deleted 0.9862 5 151
AF-A0A0Q7ELG8-F1-model_v4 DUF2214 family protein 0.9859 6 152 GO:0016020

Feature Viewer

pLDDT pTM Quality
94.52 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map