F302137

General Info

Members Datasets Scaffolds Average Seq Length
196 143 392 297

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0123094|Ga0501034_0123094_213_1184
Length 323
Sequence VRPPNKTPDIYVVYQNFVIRKPFSMHFHVLGKSTLSVSGIAFGCMSLGKNDKENAALINNAIDAGINYFDTADIYQDGFNEETLGKAVKGKRDRILIASKVGNQRRTDGSGALVWNPTKAHILSSVEGTLKRLQTDYLDLYQLHGGTMDDPIEETIDAFEILRQQGKIRYYGISSIRPNVIREYIQRSNIVSVMMQYSLLDRRPEETCLTLLEEHTIGVLARGTLAGGLLADKPADAYLNYTVDEVYKMSSAVHAISGMSRNASQTALQFVLQQAAITSAVVGIRTQQQLDDIVSAVTAPVLTDSEIAFLRSQIPVNYYSQHR

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
83 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
90 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
108 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
109 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
110 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
111 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
112 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
113 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
114 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
119 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
120 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
121 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
122 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
123 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
126 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
127 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
128 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
129 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
130 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
131 2738541278 Niastella sp. CF465 Isolate Unclassified
132 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
133 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
134 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
135 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
136 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
137 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
138 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
139 2914759650 Rhizosphaericola mali Isolate Rhizosphere
140 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
141 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
142 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
143 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.37
Metatranscriptomes 0
Isolates 6.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.27
Nodule 0
Rhizoplane 0.51
Rhizosphere 76.02
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0123094 3300049571 Bacteria 2579
2 rootH1_10048572 3300003316 Bacteria 4287
3 rootH1_10105089 3300003316 Bacteria 4517
4 rootL2_10024995 3300003322 Bacteria 3018
5 rootH1_10037911 3300003323 Bacteria 17547
6 rootH1_10058722 3300003323 Bacteria 2963
7 rootH1_10099187 3300003323 Bacteria 2004
8 rootH1_10130104 3300003323 Bacteria 3098
9 Ga0055531_10000875 3300003794 Bacteria 24688
10 Ga0065165_1011577 3300005262 Bacteria 3659
11 Ga0065165_1025158 3300005262 Bacteria 1986
12 Ga0065714_10074355 3300005288 Bacteria 3050
13 Ga0070690_100041238 3300005330 Bacteria 2922
14 Ga0070670_100052468 3300005331 Bacteria 3502
15 Ga0068869_100219171 3300005334 Bacteria 1507
16 Ga0068868_100203382 3300005338 Unclassified 1652
17 Ga0070660_100044059 3300005339 Bacteria 3411
18 Ga0070687_100024581 3300005343 Bacteria 2878
19 Ga0070661_100065189 3300005344 Bacteria 2676
20 Ga0070668_100054890 3300005347 Bacteria 3074
21 Ga0070671_100072837 3300005355 Unclassified 2870
22 Ga0070671_100281458 3300005355 Bacteria 1415
23 Ga0070674_100011071 3300005356 Bacteria 5475
24 Ga0070674_100168660 3300005356 Bacteria 1667
25 Ga0070673_100122403 3300005364 Bacteria 2172
26 Ga0070663_100055377 3300005455 Unclassified 2839
27 Ga0070681_10075829 3300005458 Bacteria 3323
28 Ga0070681_10079856 3300005458 Bacteria 3227
29 Ga0068867_100001831 3300005459 Bacteria 14825
30 Ga0068867_100200851 3300005459 Bacteria 1596
31 Ga0070685_10127732 3300005466 Bacteria 1586
32 Ga0070679_100000722 3300005530 Bacteria 28510
33 Ga0070679_100057819 3300005530 Bacteria 3865
34 Ga0070684_100062437 3300005535 Bacteria 3263
35 Ga0070672_100327198 3300005543 Bacteria 1303
36 Ga0068855_100001780 3300005563 Bacteria 26923
37 Ga0068855_100006223 3300005563 Bacteria 14544
38 Ga0068855_100344732 3300005563 Bacteria 1642
39 Ga0070664_100079211 3300005564 Bacteria 2827
40 Ga0070664_100185431 3300005564 Bacteria 1851
41 Ga0070664_100235654 3300005564 Bacteria 1642
42 Ga0068856_100072608 3300005614 Bacteria 3407
43 Ga0068852_100007235 3300005616 Bacteria 8095
44 Ga0068852_100175566 3300005616 Bacteria 2011
45 Ga0068864_100124247 3300005618 Bacteria 2311
46 Ga0068866_10008325 3300005718 Bacteria 4364
47 Ga0068861_100110440 3300005719 Bacteria 2202
48 Ga0068860_100002513 3300005843 Bacteria 19240
49 Ga0068860_100104294 3300005843 Bacteria 2707
50 Ga0068860_100282253 3300005843 Bacteria 1623
51 Ga0068871_100250679 3300006358 Bacteria 1542
52 Ga0105240_10104308 3300009093 Bacteria 3443
53 Ga0105240_10285415 3300009093 Bacteria 1895
54 Ga0111539_10056560 3300009094 Bacteria 4662
55 Ga0114129_10004621 3300009147 Bacteria 19432
56 Ga0105241_10050830 3300009174 Bacteria 3159
57 Ga0105242_10222833 3300009176 Bacteria 1686
58 Ga0105237_10134775 3300009545 Bacteria 2464
59 Ga0105249_10008218 3300009553 Bacteria 9092
60 Ga0105249_10446143 3300009553 Bacteria 1332
61 Ga0105239_10001141 3300010375 Bacteria 36571
62 Ga0157373_10009296 3300013100 Bacteria 7268
63 Ga0157371_10004893 3300013102 Bacteria 11509
64 Ga0157371_10010302 3300013102 Bacteria 7294
65 Ga0157369_10014149 3300013105 Bacteria 9014
66 Ga0157369_10034401 3300013105 Bacteria 5561
67 Ga0157374_10024312 3300013296 Bacteria 5430
68 Ga0157374_10045025 3300013296 Bacteria 4082
69 Ga0157378_10073106 3300013297 Bacteria 3082
70 Ga0163162_10000386 3300013306 Bacteria 40256
71 Ga0163162_10014974 3300013306 Bacteria 7575
72 Ga0163162_10153812 3300013306 Bacteria 2419
73 Ga0163162_10558942 3300013306 Bacteria 1272
74 Ga0163162_10588424 3300013306 Unclassified 1239
75 Ga0157372_10028969 3300013307 Bacteria 6041
76 Ga0157372_10077635 3300013307 Bacteria 3751
77 Ga0157372_10204499 3300013307 Bacteria 2288
78 Ga0157372_10369112 3300013307 Bacteria 1672
79 Ga0157375_10195948 3300013308 Bacteria 2175
80 Ga0163163_10030884 3300014325 Bacteria 5166
81 Ga0157380_10039552 3300014326 Bacteria 3668
82 Ga0157379_10030523 3300014968 Bacteria 4798
83 Ga0157379_10256231 3300014968 Bacteria 1589
84 Ga0157379_10626218 3300014968 Bacteria 1006
85 Ga0157376_10054241 3300014969 Unclassified 3341
86 Ga0163161_10005438 3300017792 Bacteria 8844
87 Ga0163161_10063971 3300017792 Bacteria 2682
88 Ga0209436_101694 3300025208 Bacteria 7271
89 Ga0209436_103184 3300025208 Bacteria 4481
90 Ga0209147_101787 3300025229 Bacteria 6760
91 Ga0209130_1001457 3300025284 Bacteria 15557
92 Ga0207426_1000177 3300025302 Bacteria 159426
93 Ga0207426_1011493 3300025302 Bacteria 3369
94 Ga0209257_1000001 3300025304 Bacteria 2274655
95 Ga0207647_10000587 3300025904 Bacteria 28282
96 Ga0207705_10003416 3300025909 Bacteria 12077
97 Ga0207660_10003175 3300025917 Bacteria 10751
98 Ga0207657_10046750 3300025919 Bacteria 3789
99 Ga0207652_10000159 3300025921 Bacteria 73101
100 Ga0207652_10000329 3300025921 Bacteria 49068
101 Ga0207650_10047667 3300025925 Bacteria 3158
102 Ga0207644_10064741 3300025931 Bacteria 2657
103 Ga0207690_10198115 3300025932 Bacteria 1523
104 Ga0207679_10019492 3300025945 Bacteria 4558
105 Ga0207667_10000935 3300025949 Bacteria 37245
106 Ga0207667_10126748 3300025949 Bacteria 2630
107 Ga0207677_10251500 3300026023 Unclassified 1435
108 Ga0207678_10052605 3300026067 Bacteria 3512
109 Ga0207702_10068983 3300026078 Bacteria 3039
110 Ga0207648_10008856 3300026089 Bacteria 9689
111 Ga0207674_10091309 3300026116 Bacteria 3035
112 Ga0207674_10219879 3300026116 Bacteria 1848
113 Ga0207675_100006948 3300026118 Bacteria 10708
114 Ga0207675_100193586 3300026118 Bacteria 1951
115 Ga0207683_10056894 3300026121 Bacteria 3432
116 Ga0268266_10707426 3300028379 Unclassified 971
117 Ga0268264_10230894 3300028381 Bacteria 1709
118 Ga0265327_10169430 3300031251 Bacteria 1004
119 Ga0307513_10074799 3300031456 Bacteria 3521
120 Ga0307513_10128265 3300031456 Bacteria 2487
121 Ga0307513_10165088 3300031456 Bacteria 2100
122 Ga0307514_10076040 3300031649 Bacteria 2502
123 Ga0316576_10192408 3300031727 Bacteria 1538
124 Ga0395899_0009137 3300037312 Bacteria 7615
125 Ga0395899_0049049 3300037312 Bacteria 3139
126 Ga0395900_0041579 3300037418 Bacteria 4738
127 Ga0395900_0062364 3300037418 Bacteria 3832
128 Ga0395898_0012336 3300037466 Bacteria 8838
129 Ga0395898_0033784 3300037466 Bacteria 5101
130 Ga0395898_0273331 3300037466 Bacteria 1612
131 Ga0395905_0070220 3300037471 Bacteria 3281
132 Ga0395905_0219648 3300037471 Bacteria 1779
133 Ga0395901_0017489 3300038443 Bacteria 7318
134 Ga0400483_043881 3300039062 Unclassified 2253
135 Ga0439457_000700 3300042014 Bacteria 9918
136 Ga0451577_0433482 3300042876 Bacteria 1194
137 Ga0466969_0000693 3300044656 Bacteria 18276
138 Ga0466972_0000032 3300044658 Bacteria 159445
139 Ga0466972_0010707 3300044658 Bacteria 4601
140 Ga0466966_0000124 3300044684 Bacteria 48900
141 Ga0466964_0220420 3300044706 Unclassified 921
142 Ga0453684_0034772 3300044712 Bacteria 6983
143 Ga0466957_0002906 3300044842 Bacteria 9283
144 Ga0466957_0024567 3300044842 Bacteria 3566
145 Ga0466959_0000012 3300045049 Bacteria 168961
146 Ga0466959_0080510 3300045049 Bacteria 2348
147 Ga0495638_0000003 3300046460 Bacteria 888792
148 Ga0495611_0002268 3300046648 Bacteria 8911
149 Ga0495625_0060889 3300046660 Bacteria 2673
150 Ga0495660_0118121 3300046810 Bacteria 1345
151 Ga0495672_0201937 3300047320 Bacteria 994
152 Ga0496101_0102200 3300048904 Bacteria 2147
153 Ga0496126_0012507 3300048929 Bacteria 8689
154 Ga0501036_0281283 3300049572 Bacteria 1392
155 Ga0501217_003565 3300049661 Bacteria 3151
156 Ga0501217_010524 3300049661 Bacteria 2028
157 Ga0501233_005781 3300049668 Bacteria 2301
158 Ga0501247_009367 3300049677 Bacteria 1154
159 Ga0501250_001932 3300049680 Bacteria 1803
160 Ga0501257_002091 3300049686 Bacteria 4170
161 Ga0501257_033602 3300049686 Bacteria 1244
162 Ga0501259_001487 3300049688 Bacteria 3893
163 Ga0501225_0000345 3300049705 Bacteria 14674
164 Ga0501245_000882 3300049708 Bacteria 3805
165 Ga0501035_0073800 3300049822 Bacteria 3019
166 Ga0501044_0005906 3300049823 Bacteria 13557
167 nmdc:mga05p37_1825_c1 3300050507 Bacteria 3643
168 Ga0500578_0000001 3300053086 Bacteria 317120
169 Ga0500583_0000100 3300053092 Bacteria 47289
170 Ga0500650_0041816 3300053098 Bacteria 2117
171 Ga0500569_000090 3300053109 Bacteria 14410
172 Ga0500655_012625 3300053133 Bacteria 1537
173 Ga0500658_0003720 3300053134 Bacteria 5746
174 Ga0500658_0029358 3300053134 Bacteria 2139
175 Ga0500568_0004276 3300053139 Bacteria 7671
176 Ga0500577_0007862 3300053142 Bacteria 3009
177 Ga0500588_0000267 3300053146 Bacteria 7604
178 Ga0500604_0014910 3300053151 Bacteria 2121
179 Ga0500616_0000068 3300053153 Bacteria 235628
180 Ga0500622_0000103 3300053156 Bacteria 86203
181 Ga0500622_0000181 3300053156 Bacteria 67823
182 Ga0500622_0001144 3300053156 Bacteria 22146
183 Ga0500611_000077 3300053727 Bacteria 38126
184 2738728824 2738541278 Bacteria 9755573
185 2817480611 2816332295 Bacteria 4352468
186 2819573179 2818991442 Bacteria 8318214
187 2821136598 2821136567 Bacteria 8080116
188 2883069176 2883068021 Bacteria 6192739
189 2896087957 2896085136 Bacteria 6129793
190 2904468657 2904467357 Bacteria 8057758
191 2910248980 2910245624 Bacteria 6935613
192 2914762364 2914759650 Bacteria 4701441
193 2929240781 2929239360 Bacteria 7745570
194 3006860962 3006858327 Bacteria 4317835
195 3006881491 3006879489 Bacteria 4064221
196 8055589648 8055588893 Bacteria 3619545
197 Ga0501034_0123094
198 rootH1_10048572
199 rootH1_10105089
200 rootL2_10024995
201 rootH1_10037911
202 rootH1_10058722
203 rootH1_10099187
204 rootH1_10130104
205 Ga0055531_10000875
206 Ga0065165_1011577
207 Ga0065165_1025158
208 Ga0065714_10074355
209 Ga0070690_100041238
210 Ga0070670_100052468
211 Ga0068869_100219171
212 Ga0068868_100203382
213 Ga0070660_100044059
214 Ga0070687_100024581
215 Ga0070661_100065189
216 Ga0070668_100054890
217 Ga0070671_100072837
218 Ga0070671_100281458
219 Ga0070674_100011071
220 Ga0070674_100168660
221 Ga0070673_100122403
222 Ga0070663_100055377
223 Ga0070681_10075829
224 Ga0070681_10079856
225 Ga0068867_100001831
226 Ga0068867_100200851
227 Ga0070685_10127732
228 Ga0070679_100000722
229 Ga0070679_100057819
230 Ga0070684_100062437
231 Ga0070672_100327198
232 Ga0068855_100001780
233 Ga0068855_100006223
234 Ga0068855_100344732
235 Ga0070664_100079211
236 Ga0070664_100185431
237 Ga0070664_100235654
238 Ga0068856_100072608
239 Ga0068852_100007235
240 Ga0068852_100175566
241 Ga0068864_100124247
242 Ga0068866_10008325
243 Ga0068861_100110440
244 Ga0068860_100002513
245 Ga0068860_100104294
246 Ga0068860_100282253
247 Ga0068871_100250679
248 Ga0105240_10104308
249 Ga0105240_10285415
250 Ga0111539_10056560
251 Ga0114129_10004621
252 Ga0105241_10050830
253 Ga0105242_10222833
254 Ga0105237_10134775
255 Ga0105249_10008218
256 Ga0105249_10446143
257 Ga0105239_10001141
258 Ga0157373_10009296
259 Ga0157371_10004893
260 Ga0157371_10010302
261 Ga0157369_10014149
262 Ga0157369_10034401
263 Ga0157374_10024312
264 Ga0157374_10045025
265 Ga0157378_10073106
266 Ga0163162_10000386
267 Ga0163162_10014974
268 Ga0163162_10153812
269 Ga0163162_10558942
270 Ga0163162_10588424
271 Ga0157372_10028969
272 Ga0157372_10077635
273 Ga0157372_10204499
274 Ga0157372_10369112
275 Ga0157375_10195948
276 Ga0163163_10030884
277 Ga0157380_10039552
278 Ga0157379_10030523
279 Ga0157379_10256231
280 Ga0157379_10626218
281 Ga0157376_10054241
282 Ga0163161_10005438
283 Ga0163161_10063971
284 Ga0209436_101694
285 Ga0209436_103184
286 Ga0209147_101787
287 Ga0209130_1001457
288 Ga0207426_1000177
289 Ga0207426_1011493
290 Ga0209257_1000001
291 Ga0207647_10000587
292 Ga0207705_10003416
293 Ga0207660_10003175
294 Ga0207657_10046750
295 Ga0207652_10000159
296 Ga0207652_10000329
297 Ga0207650_10047667
298 Ga0207644_10064741
299 Ga0207690_10198115
300 Ga0207679_10019492
301 Ga0207667_10000935
302 Ga0207667_10126748
303 Ga0207677_10251500
304 Ga0207678_10052605
305 Ga0207702_10068983
306 Ga0207648_10008856
307 Ga0207674_10091309
308 Ga0207674_10219879
309 Ga0207675_100006948
310 Ga0207675_100193586
311 Ga0207683_10056894
312 Ga0268266_10707426
313 Ga0268264_10230894
314 Ga0265327_10169430
315 Ga0307513_10074799
316 Ga0307513_10128265
317 Ga0307513_10165088
318 Ga0307514_10076040
319 Ga0316576_10192408
320 Ga0395899_0009137
321 Ga0395899_0049049
322 Ga0395900_0041579
323 Ga0395900_0062364
324 Ga0395898_0012336
325 Ga0395898_0033784
326 Ga0395898_0273331
327 Ga0395905_0070220
328 Ga0395905_0219648
329 Ga0395901_0017489
330 Ga0400483_043881
331 Ga0439457_000700
332 Ga0451577_0433482
333 Ga0466969_0000693
334 Ga0466972_0000032
335 Ga0466972_0010707
336 Ga0466966_0000124
337 Ga0466964_0220420
338 Ga0453684_0034772
339 Ga0466957_0002906
340 Ga0466957_0024567
341 Ga0466959_0000012
342 Ga0466959_0080510
343 Ga0495638_0000003
344 Ga0495611_0002268
345 Ga0495625_0060889
346 Ga0495660_0118121
347 Ga0495672_0201937
348 Ga0496101_0102200
349 Ga0496126_0012507
350 Ga0501036_0281283
351 Ga0501217_003565
352 Ga0501217_010524
353 Ga0501233_005781
354 Ga0501247_009367
355 Ga0501250_001932
356 Ga0501257_002091
357 Ga0501257_033602
358 Ga0501259_001487
359 Ga0501225_0000345
360 Ga0501245_000882
361 Ga0501035_0073800
362 Ga0501044_0005906
363 nmdc:mga05p37_1825_c1
364 Ga0500578_0000001
365 Ga0500583_0000100
366 Ga0500650_0041816
367 Ga0500569_000090
368 Ga0500655_012625
369 Ga0500658_0003720
370 Ga0500658_0029358
371 Ga0500568_0004276
372 Ga0500577_0007862
373 Ga0500588_0000267
374 Ga0500604_0014910
375 Ga0500616_0000068
376 Ga0500622_0000103
377 Ga0500622_0000181
378 Ga0500622_0001144
379 Ga0500611_000077
380 2738728824
381 2817480611
382 2819573179
383 2821136598
384 2883069176
385 2896087957
386 2904468657
387 2910248980
388 2914762364
389 2929240781
390 3006860962
391 3006881491
392 8055589648

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

39

314

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ynq-assembly2.cif.gz_B aldo-keto reductase akr11c1 from bacillus halodurans (holo form) 0.9311 1 295
1ynq-assembly2.cif.gz_B aldo-keto reductase akr11c1 from bacillus halodurans (holo form) 0.9251 1 295
1ynq-assembly1.cif.gz_A aldo-keto reductase akr11c1 from bacillus halodurans (holo form) 0.9017 1 295
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8983 1 287
1ynp-assembly1.cif.gz_A aldo-keto reductase akr11c1 from bacillus halodurans (apo form) 0.8968 1 295
ID Description Score Start End Superfamily
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9411 1 288 3.20.20.100
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9348 1 288 3.20.20.100
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9325 3 196 3.20.20.100
af_Q2FY71_1_289_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9215 1 284 3.20.20.100
af_A0A0P0W8U8_11_146_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.912 1 126 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A1M5GJI2-F1-model_v4 Predicted oxidoreductase 0.9781 3 296 GO:0016491
AF-C2FVU4-F1-model_v4 Oxidoreductase, aldo/keto reductase family protein 0.9737 1 191
AF-A0A1I0QY56-F1-model_v4 Predicted oxidoreductase 0.9708 1 295
AF-A0A855Y0R7-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.9703 1 296 GO:0016491
AF-A0A1M5GJI2-F1-model_v4 Predicted oxidoreductase 0.9684 3 296 GO:0016491

Map