F302131

General Info

Members Datasets Scaffolds Average Seq Length
196 139 392 150

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0206966|Ga0501032_0206966_752_1261
Length 169
Sequence MTKLDSQLSCLVHAACVEIGGRGVLILGPPGAGKSDLALRLIDQAGSGIVGSLKPAFLVADDQVIVTAEASSLKARAPKALQGLLEIRGLGILQVPHRRTTSLALAISLMPASDIERMPEADYLAHDILGLRLPIVRLDPHAASAPARVRAALDGLSASEPSVLSTSSR

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
66 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
67 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
68 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
69 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
70 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
71 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
72 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
73 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
74 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
75 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
76 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
83 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
88 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
127 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
130 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
133 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
134 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
135 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
136 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
137 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
138 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
139 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.41
Metatranscriptomes 1.02
Isolates 3.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 3.57
Rhizosphere 89.29
Stem 0
Stem Tuber 0
Unclassified 8.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0206966 3300049569 Bacteria 1280
2 Ga0065715_10009682 3300005293 Bacteria 4187
3 Ga0070676_10478617 3300005328 Unclassified 880
4 Ga0070680_100001778 3300005336 Bacteria 15827
5 Ga0070680_100177074 3300005336 Bacteria 1795
6 Ga0070668_100386351 3300005347 Unclassified 1192
7 Ga0070671_100492778 3300005355 Bacteria 1054
8 Ga0070694_100110093 3300005444 Bacteria 1961
9 Ga0070681_10014846 3300005458 Bacteria 7744
10 Ga0070681_10059150 3300005458 Bacteria 3811
11 Ga0070706_100056961 3300005467 Bacteria 3606
12 Ga0070707_100703643 3300005468 Bacteria 973
13 Ga0070698_100003581 3300005471 Bacteria 17065
14 Ga0070679_100002334 3300005530 Bacteria 17162
15 Ga0070679_100008329 3300005530 Bacteria 9754
16 Ga0070695_100029905 3300005545 Bacteria 3388
17 Ga0068855_100337370 3300005563 Bacteria 1663
18 Ga0068854_100403828 3300005578 Bacteria 1131
19 Ga0068856_100247432 3300005614 Bacteria 1798
20 Ga0068859_101288411 3300005617 Bacteria 805
21 Ga0068864_100002207 3300005618 Bacteria 16075
22 Ga0068864_101658594 3300005618 Bacteria 644
23 Ga0068861_100046499 3300005719 Bacteria 3272
24 Ga0081540_1000012 3300005983 Bacteria 189939
25 Ga0081540_1072797 3300005983 Bacteria 1581
26 Ga0070717_10000669 3300006028 Bacteria 22050
27 Ga0075428_100018439 3300006844 Bacteria 7717
28 Ga0075428_100425736 3300006844 Unclassified 1422
29 Ga0075428_100550381 3300006844 Bacteria 1233
30 Ga0075430_100048314 3300006846 Bacteria 3593
31 Ga0075431_100001455 3300006847 Bacteria 21831
32 Ga0075431_100024697 3300006847 Bacteria 6162
33 Ga0075433_10000401 3300006852 Bacteria 27591
34 Ga0075433_10479273 3300006852 Bacteria 1096
35 Ga0075434_100438696 3300006871 Bacteria 1327
36 Ga0075429_100214356 3300006880 Bacteria 1687
37 Ga0068865_101943907 3300006881 Unclassified 533
38 Ga0097620_101288397 3300006931 Bacteria 805
39 Ga0075435_100002030 3300007076 Bacteria 13245
40 Ga0075435_100104053 3300007076 Bacteria 2355
41 Ga0099794_10327257 3300007265 Bacteria 795
42 Ga0105240_10207140 3300009093 Bacteria 2294
43 Ga0105240_10769820 3300009093 Bacteria 1045
44 Ga0111539_10015715 3300009094 Bacteria 9405
45 Ga0111539_10052751 3300009094 Bacteria 4841
46 Ga0111539_10086241 3300009094 Bacteria 3689
47 Ga0114129_10016350 3300009147 Bacteria 10562
48 Ga0114129_10020848 3300009147 Bacteria 9311
49 Ga0114129_10328311 3300009147 Bacteria 2032
50 Ga0114129_10586876 3300009147 Bacteria 1445
51 Ga0114129_10656634 3300009147 Bacteria 1353
52 Ga0114129_10915352 3300009147 Bacteria 1110
53 Ga0105242_10074765 3300009176 Bacteria 2820
54 Ga0105249_10361720 3300009553 Bacteria 1473
55 Ga0157370_10005106 3300013104 Bacteria 14807
56 Ga0157370_10039386 3300013104 Bacteria 4567
57 Ga0157378_10835194 3300013297 Unclassified 949
58 Ga0163163_10772678 3300014325 Bacteria 1024
59 Ga0163163_12094205 3300014325 Bacteria 625
60 Ga0157380_10397207 3300014326 Bacteria 1307
61 Ga0157376_10285554 3300014969 Bacteria 1556
62 Ga0157376_10809484 3300014969 Bacteria 950
63 Ga0206354_11467752 3300020081 Bacteria 5166
64 Ga0206353_12066863 3300020082 Bacteria 22106
65 Ga0213875_10113708 3300021388 Bacteria 1265
66 Ga0213875_10183790 3300021388 Bacteria 982
67 Ga0207692_10684593 3300025898 Bacteria 665
68 Ga0207699_10199805 3300025906 Bacteria 1354
69 Ga0207684_10054344 3300025910 Bacteria 3397
70 Ga0207707_10000502 3300025912 Bacteria 40345
71 Ga0207707_10187562 3300025912 Bacteria 1804
72 Ga0207660_10026330 3300025917 Bacteria 3960
73 Ga0207660_10447553 3300025917 Bacteria 1044
74 Ga0207646_10883171 3300025922 Bacteria 794
75 Ga0207650_10654177 3300025925 Bacteria 886
76 Ga0207686_10141047 3300025934 Bacteria 1666
77 Ga0207667_10131004 3300025949 Bacteria 2583
78 Ga0207640_11816189 3300025981 Bacteria 551
79 Ga0207641_10000342 3300026088 Bacteria 56068
80 Ga0207676_10002954 3300026095 Bacteria 12127
81 Ga0207674_10005358 3300026116 Bacteria 15258
82 Ga0207675_100069692 3300026118 Bacteria 3287
83 Ga0207428_10150951 3300027907 Bacteria 1769
84 Ga0207428_10313179 3300027907 Bacteria 1160
85 Ga0265327_10001637 3300031251 Bacteria 27006
86 Ga0265327_10020345 3300031251 Bacteria 4048
87 Ga0265314_10037952 3300031711 Bacteria 3485
88 Ga0307413_10928832 3300031824 Bacteria 741
89 Ga0307412_10142338 3300031911 Bacteria 1758
90 Ga0307415_100301736 3300032126 Bacteria 1327
91 Ga0373930_0029686 3300034816 Bacteria 1119
92 Ga0373959_0019722 3300034820 Bacteria 1280
93 Ga0373938_0002874 3300034957 Bacteria 2781
94 Ga0373929_0030130 3300035085 Bacteria 1155
95 Ga0373940_0022955 3300035088 Bacteria 1607
96 Ga0373940_0071644 3300035088 Bacteria 1010
97 Ga0373949_0007396 3300035090 Bacteria 2404
98 Ga0373949_0021353 3300035090 Bacteria 1487
99 Ga0373951_0035874 3300035091 Bacteria 1182
100 Ga0373932_0004691 3300035112 Bacteria 3228
101 Ga0373932_0007232 3300035112 Bacteria 2640
102 Ga0373939_0010263 3300035114 Bacteria 2337
103 Ga0373939_0085914 3300035114 Bacteria 1054
104 Ga0373960_0003685 3300035121 Bacteria 3478
105 Ga0373942_0075981 3300035207 Bacteria 989
106 Ga0373961_0003498 3300035241 Bacteria 3883
107 Ga0373961_0013597 3300035241 Bacteria 2055
108 Ga0373931_0000812 3300035691 Bacteria 13090
109 Ga0373931_0830782 3300035691 Unclassified 617
110 Ga0373927_0124499 3300035695 Bacteria 1683
111 Ga0373937_0118244 3300036401 Bacteria 2469
112 Ga0395905_0076622 3300037471 Bacteria 3134
113 Ga0436364_0110006 3300037853 Bacteria 1263
114 Ga0436364_0480370 3300037853 Bacteria 5262
115 Ga0400485_08450 3300038735 Unclassified 1235
116 Ga0400486_06700 3300038742 Unclassified 1303
117 Ga0451577_0255103 3300042876 Bacteria 1588
118 Ga0453684_0000020 3300044712 Bacteria 879938
119 Ga0466967_1233746 3300045976 Bacteria 745
120 Ga0495656_0034820 3300046615 Bacteria 2065
121 Ga0495659_0102511 3300046664 Bacteria 1110
122 Ga0496106_0395138 3300048909 Unclassified 1111
123 Ga0496108_0290238 3300048911 Bacteria 1424
124 Ga0496108_0632618 3300048911 Unclassified 931
125 Ga0496109_0131205 3300048912 Bacteria 2339
126 Ga0496110_0354203 3300048913 Bacteria 1337
127 Ga0496112_0209708 3300048915 Bacteria 1906
128 Ga0496115_0222945 3300048918 Bacteria 1556
129 Ga0496119_0455603 3300048922 Bacteria 602
130 Ga0501033_0021067 3300049570 Bacteria 4921
131 Ga0501036_0316931 3300049572 Bacteria 1303
132 Ga0501038_0345157 3300049574 Bacteria 1160
133 Ga0501039_0142130 3300049575 Bacteria 1885
134 Ga0501040_0023393 3300049576 Bacteria 4143
135 Ga0501040_0421883 3300049576 Bacteria 959
136 Ga0501041_0005863 3300049577 Bacteria 7183
137 Ga0501042_0086794 3300049578 Bacteria 2244
138 Ga0501042_0627673 3300049578 Unclassified 781
139 Ga0501046_0047702 3300049580 Bacteria 3395
140 Ga0501048_0529287 3300049582 Bacteria 845
141 Ga0501070_0019498 3300049586 Bacteria 5688
142 Ga0501071_0526943 3300049587 Unclassified 907
143 Ga0501072_0023879 3300049588 Bacteria 4751
144 Ga0501072_0045614 3300049588 Bacteria 3447
145 Ga0501073_0044773 3300049589 Bacteria 3119
146 Ga0501074_0285538 3300049590 Unclassified 1173
147 Ga0501074_0388146 3300049590 Unclassified 990
148 Ga0501074_0482652 3300049590 Bacteria 878
149 Ga0501075_0002222 3300049591 Bacteria 12856
150 Ga0501075_0072855 3300049591 Bacteria 2597
151 Ga0501075_0911557 3300049591 Unclassified 668
152 Ga0501076_0057500 3300049592 Bacteria 3088
153 Ga0501076_0091221 3300049592 Bacteria 2451
154 Ga0501077_0035600 3300049593 Bacteria 3169
155 Ga0501079_0006819 3300049741 Bacteria 8596
156 Ga0501079_0084744 3300049741 Bacteria 2452
157 Ga0501080_0022359 3300049742 Bacteria 5859
158 Ga0501081_0000962 3300049743 Bacteria 17136
159 Ga0501081_0237658 3300049743 Bacteria 1328
160 Ga0501083_0018466 3300049744 Bacteria 4859
161 Ga0501035_0238119 3300049822 Bacteria 1549
162 Ga0501045_0008970 3300049824 Bacteria 6985
163 Ga0501045_0200406 3300049824 Bacteria 1487
164 nmdc:mga05p37_30998_c1 3300050507 Bacteria 6529
165 nmdc:mga05p37_435431_c1 3300050507 Bacteria 1522
166 nmdc:mga05p37_442272_c1 3300050507 Bacteria 1507
167 nmdc:mga09592_282199_c1 3300050508 Bacteria 1440
168 nmdc:mga09592_36207_c1 3300050508 Bacteria 4134
169 nmdc:mga0qj67_26943_c1 3300050509 Bacteria 4451
170 nmdc:mga06r32_2435_c1 3300050510 Bacteria 16647
171 nmdc:mga06r32_7642_c1 3300050510 Bacteria 9721
172 nmdc:mga08y16_114950_c1 3300050511 Bacteria 2802
173 nmdc:mga08y16_380553_c1 3300050511 Bacteria 1447
174 nmdc:mga08y16_400599_c1 3300050511 Unclassified 1405
175 nmdc:mga08y16_899764_c1 3300050511 Bacteria 871
176 nmdc:mga0rr50_1668_c1 3300050513 Bacteria 12233
177 nmdc:mga0rr50_32131_c1 3300050513 Bacteria 3736
178 nmdc:mga0a205_175948_c1 3300050515 Bacteria 2035
179 nmdc:mga0a205_4491_c1 3300050515 Bacteria 12520
180 Ga0495612_0140573 3300053078 Bacteria 1047
181 Ga0500555_012543 3300053103 Bacteria 2440
182 Ga0501084_0003747 3300054114 Bacteria 12352
183 Ga0501084_0158682 3300054114 Bacteria 1908
184 Ga0501084_0171207 3300054114 Bacteria 1833
185 Ga0590071_012670 3300059421 Bacteria 1975
186 Ga0590077_006468 3300059426 Bacteria 2400
187 Ga0501082_0002853 3300060353 Bacteria 15057
188 Ga0501082_0040140 3300060353 Bacteria 4037
189 Ga0530510_1201765 3300061734 Bacteria 581
190 2643730283 2643221541 Bacteria 5498788
191 2644043452 2643221606 Bacteria 5588032
192 2644087747 2643221614 Bacteria 4260023
193 2644345351 2643221661 Bacteria 4267604
194 2644367103 2643221666 Bacteria 4265935
195 2644393611 2643221671 Bacteria 5496681
196 2883355023 2883354860 Bacteria 5865246
197 Ga0501032_0206966
198 Ga0065715_10009682
199 Ga0070676_10478617
200 Ga0070680_100001778
201 Ga0070680_100177074
202 Ga0070668_100386351
203 Ga0070671_100492778
204 Ga0070694_100110093
205 Ga0070681_10014846
206 Ga0070681_10059150
207 Ga0070706_100056961
208 Ga0070707_100703643
209 Ga0070698_100003581
210 Ga0070679_100002334
211 Ga0070679_100008329
212 Ga0070695_100029905
213 Ga0068855_100337370
214 Ga0068854_100403828
215 Ga0068856_100247432
216 Ga0068859_101288411
217 Ga0068864_100002207
218 Ga0068864_101658594
219 Ga0068861_100046499
220 Ga0081540_1000012
221 Ga0081540_1072797
222 Ga0070717_10000669
223 Ga0075428_100018439
224 Ga0075428_100425736
225 Ga0075428_100550381
226 Ga0075430_100048314
227 Ga0075431_100001455
228 Ga0075431_100024697
229 Ga0075433_10000401
230 Ga0075433_10479273
231 Ga0075434_100438696
232 Ga0075429_100214356
233 Ga0068865_101943907
234 Ga0097620_101288397
235 Ga0075435_100002030
236 Ga0075435_100104053
237 Ga0099794_10327257
238 Ga0105240_10207140
239 Ga0105240_10769820
240 Ga0111539_10015715
241 Ga0111539_10052751
242 Ga0111539_10086241
243 Ga0114129_10016350
244 Ga0114129_10020848
245 Ga0114129_10328311
246 Ga0114129_10586876
247 Ga0114129_10656634
248 Ga0114129_10915352
249 Ga0105242_10074765
250 Ga0105249_10361720
251 Ga0157370_10005106
252 Ga0157370_10039386
253 Ga0157378_10835194
254 Ga0163163_10772678
255 Ga0163163_12094205
256 Ga0157380_10397207
257 Ga0157376_10285554
258 Ga0157376_10809484
259 Ga0206354_11467752
260 Ga0206353_12066863
261 Ga0213875_10113708
262 Ga0213875_10183790
263 Ga0207692_10684593
264 Ga0207699_10199805
265 Ga0207684_10054344
266 Ga0207707_10000502
267 Ga0207707_10187562
268 Ga0207660_10026330
269 Ga0207660_10447553
270 Ga0207646_10883171
271 Ga0207650_10654177
272 Ga0207686_10141047
273 Ga0207667_10131004
274 Ga0207640_11816189
275 Ga0207641_10000342
276 Ga0207676_10002954
277 Ga0207674_10005358
278 Ga0207675_100069692
279 Ga0207428_10150951
280 Ga0207428_10313179
281 Ga0265327_10001637
282 Ga0265327_10020345
283 Ga0265314_10037952
284 Ga0307413_10928832
285 Ga0307412_10142338
286 Ga0307415_100301736
287 Ga0373930_0029686
288 Ga0373959_0019722
289 Ga0373938_0002874
290 Ga0373929_0030130
291 Ga0373940_0022955
292 Ga0373940_0071644
293 Ga0373949_0007396
294 Ga0373949_0021353
295 Ga0373951_0035874
296 Ga0373932_0004691
297 Ga0373932_0007232
298 Ga0373939_0010263
299 Ga0373939_0085914
300 Ga0373960_0003685
301 Ga0373942_0075981
302 Ga0373961_0003498
303 Ga0373961_0013597
304 Ga0373931_0000812
305 Ga0373931_0830782
306 Ga0373927_0124499
307 Ga0373937_0118244
308 Ga0395905_0076622
309 Ga0436364_0110006
310 Ga0436364_0480370
311 Ga0400485_08450
312 Ga0400486_06700
313 Ga0451577_0255103
314 Ga0453684_0000020
315 Ga0466967_1233746
316 Ga0495656_0034820
317 Ga0495659_0102511
318 Ga0496106_0395138
319 Ga0496108_0290238
320 Ga0496108_0632618
321 Ga0496109_0131205
322 Ga0496110_0354203
323 Ga0496112_0209708
324 Ga0496115_0222945
325 Ga0496119_0455603
326 Ga0501033_0021067
327 Ga0501036_0316931
328 Ga0501038_0345157
329 Ga0501039_0142130
330 Ga0501040_0023393
331 Ga0501040_0421883
332 Ga0501041_0005863
333 Ga0501042_0086794
334 Ga0501042_0627673
335 Ga0501046_0047702
336 Ga0501048_0529287
337 Ga0501070_0019498
338 Ga0501071_0526943
339 Ga0501072_0023879
340 Ga0501072_0045614
341 Ga0501073_0044773
342 Ga0501074_0285538
343 Ga0501074_0388146
344 Ga0501074_0482652
345 Ga0501075_0002222
346 Ga0501075_0072855
347 Ga0501075_0911557
348 Ga0501076_0057500
349 Ga0501076_0091221
350 Ga0501077_0035600
351 Ga0501079_0006819
352 Ga0501079_0084744
353 Ga0501080_0022359
354 Ga0501081_0000962
355 Ga0501081_0237658
356 Ga0501083_0018466
357 Ga0501035_0238119
358 Ga0501045_0008970
359 Ga0501045_0200406
360 nmdc:mga05p37_30998_c1
361 nmdc:mga05p37_435431_c1
362 nmdc:mga05p37_442272_c1
363 nmdc:mga09592_282199_c1
364 nmdc:mga09592_36207_c1
365 nmdc:mga0qj67_26943_c1
366 nmdc:mga06r32_2435_c1
367 nmdc:mga06r32_7642_c1
368 nmdc:mga08y16_114950_c1
369 nmdc:mga08y16_380553_c1
370 nmdc:mga08y16_400599_c1
371 nmdc:mga08y16_899764_c1
372 nmdc:mga0rr50_1668_c1
373 nmdc:mga0rr50_32131_c1
374 nmdc:mga0a205_175948_c1
375 nmdc:mga0a205_4491_c1
376 Ga0495612_0140573
377 Ga0500555_012543
378 Ga0501084_0003747
379 Ga0501084_0158682
380 Ga0501084_0171207
381 Ga0590071_012670
382 Ga0590077_006468
383 Ga0501082_0002853
384 Ga0501082_0040140
385 Ga0530510_1201765
386 2643730283
387 2644043452
388 2644087747
389 2644345351
390 2644367103
391 2644393611
392 2883355023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07475

Hpr_kinase_C

HPr Serine kinase C-terminal domain

6

149

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1knx-assembly1.cif.gz_C hpr kinase/phosphatase from mycoplasma pneumoniae 0.8343 4 145
1knx-assembly1.cif.gz_E hpr kinase/phosphatase from mycoplasma pneumoniae 0.8318 4 145
1ko7-assembly1.cif.gz_B x-ray structure of the hpr kinase/phosphatase from staphylococcus xylosus at 1.95 a resolution 0.8317 4 145
2qmh-assembly2.cif.gz_K structure of v267f mutant hprk/p 0.8236 4 145
1kkl-assembly1.cif.gz_C l.casei hprk/p in complex with b.subtilis hpr 0.8188 4 150
ID Description Score Start End Superfamily
2qmhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.802 4 150 3.40.50.300
1knxD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7987 4 145 3.40.50.300
3tqfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7561 6 150 3.40.50.300
1knxD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7498 4 145 3.40.50.300
2qmhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7376 4 150 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A349PSN5-F1-model_v4 HPr kinase/phosphorylase 0.9847 51 97 GO:0000155
GO:0005524
GO:0006109
AF-A0A7Y2FT34-F1-model_v4 Serine/threonine protein kinase 0.9724 8 150 GO:0000155
GO:0004674
GO:0005524
GO:0006109
AF-A0A3N5GSR7-F1-model_v4 Serine/threonine protein kinase 0.9664 4 148 GO:0000155
GO:0004674
GO:0005524
GO:0006109
AF-A0A6G6WUB7-F1-model_v4 Serine/threonine protein kinase 0.9616 4 145 GO:0000155
GO:0004674
GO:0005524
GO:0006109
AF-A0A7U0G0D4-F1-model_v4 deleted 0.9574 5 149

Map