F302078

General Info

Members Datasets Scaffolds Average Seq Length
196 141 392 163

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0116811|Ga0496108_0116811_1287_1787
Length 155
Sequence MTWTRTELEDAFAGYQNTVVECTRSGDWNAFADMFTEDVVYVEHAFGTLNGREAVRKWVTRTMTEFWFVVDEERGWIVCEIDNPMEDPGDGSKHGAANITILHYAGNGLWSREEDAYNPMNFLSMAKAWCLAAEAAGTLPEDAKSWLAKFGAMVR

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
60 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
61 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
62 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
63 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
64 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
65 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
66 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
67 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
68 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
69 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
87 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
88 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
89 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
94 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
121 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
122 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
123 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
124 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
125 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
127 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
128 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
129 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
130 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
131 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
132 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
133 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
134 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
135 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
136 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
137 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
138 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
139 2922554459 Rhodococcus sp. 66b Isolate Unclassified
140 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
141 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.88
Metatranscriptomes 0.51
Isolates 5.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.39
Nodule 0
Rhizoplane 2.55
Rhizosphere 70.92
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0116811 3300048911 Bacteria 2286
2 Ga0068869_100313510 3300005334 Bacteria 1270
3 Ga0070714_100219300 3300005435 Bacteria 1747
4 Ga0070714_100621005 3300005435 Bacteria 1039
5 Ga0070714_101076087 3300005435 Bacteria 783
6 Ga0070713_100024355 3300005436 Bacteria 4712
7 Ga0070710_10131924 3300005437 Bacteria 1524
8 Ga0070711_101528943 3300005439 Bacteria 583
9 Ga0070700_101564245 3300005441 Bacteria 562
10 Ga0070663_101406452 3300005455 Bacteria 618
11 Ga0070706_100806131 3300005467 Bacteria 869
12 Ga0070707_101784854 3300005468 Bacteria 582
13 Ga0070695_100903578 3300005545 Unclassified 713
14 Ga0068854_100162246 3300005578 Bacteria 1732
15 Ga0068856_100100790 3300005614 Bacteria 2881
16 Ga0068856_100238773 3300005614 Bacteria 1833
17 Ga0068852_100120097 3300005616 Bacteria 2404
18 Ga0068858_100499467 3300005842 Bacteria 1175
19 Ga0081455_10194793 3300005937 Bacteria 1523
20 Ga0070717_11182385 3300006028 Bacteria 696
21 Ga0075365_10086173 3300006038 Bacteria 2135
22 Ga0075368_10211811 3300006042 Bacteria 822
23 Ga0075363_100068943 3300006048 Bacteria 1918
24 Ga0075363_100076253 3300006048 Bacteria 1827
25 Ga0075363_100285763 3300006048 Unclassified 955
26 Ga0075363_100420188 3300006048 Bacteria 787
27 Ga0075364_10002875 3300006051 Bacteria 9704
28 Ga0075364_10021911 3300006051 Bacteria 4030
29 Ga0075364_10299422 3300006051 Bacteria 1095
30 Ga0075364_10334861 3300006051 Bacteria 1031
31 Ga0070716_100260508 3300006173 Bacteria 1186
32 Ga0070712_100714727 3300006175 Bacteria 855
33 Ga0075367_10189351 3300006178 Bacteria 1284
34 Ga0075369_10008229 3300006186 Bacteria 4007
35 Ga0075369_10022169 3300006186 Bacteria 2618
36 Ga0075370_10018959 3300006353 Bacteria 3737
37 Ga0075370_10056126 3300006353 Bacteria 2238
38 Ga0075370_10229908 3300006353 Bacteria 1097
39 Ga0075428_101551773 3300006844 Bacteria 693
40 Ga0075436_100635450 3300006914 Bacteria 788
41 Ga0075436_101120720 3300006914 Unclassified 593
42 Ga0099795_10016936 3300007788 Bacteria 2316
43 Ga0105240_12014649 3300009093 Bacteria 600
44 Ga0105245_10009288 3300009098 Bacteria 8574
45 Ga0105243_10000454 3300009148 Bacteria 42589
46 Ga0105241_10071585 3300009174 Bacteria 2692
47 Ga0105239_11265600 3300010375 Bacteria 851
48 Ga0157369_10059265 3300013105 Bacteria 4128
49 Ga0163162_10094723 3300013306 Bacteria 3072
50 Ga0163161_10421294 3300017792 Bacteria 1074
51 Ga0213873_10166083 3300021358 Unclassified 671
52 Ga0207692_10138518 3300025898 Bacteria 1382
53 Ga0207687_10027366 3300025927 Bacteria 3825
54 Ga0207664_10163034 3300025929 Bacteria 1903
55 Ga0207664_10925141 3300025929 Bacteria 783
56 Ga0207709_10008738 3300025935 Bacteria 5588
57 Ga0207665_10276937 3300025939 Bacteria 1247
58 Ga0207667_10040384 3300025949 Bacteria 4968
59 Ga0207640_10181046 3300025981 Bacteria 1580
60 Ga0207703_10437281 3300026035 Bacteria 1220
61 Ga0207702_10079330 3300026078 Bacteria 2845
62 Ga0207702_10451820 3300026078 Bacteria 1247
63 Ga0207698_10657111 3300026142 Bacteria 1039
64 Ga0209179_1019095 3300027512 Bacteria 1316
65 Ga0265762_1047644 3300030760 Bacteria 853
66 Ga0265327_10000071 3300031251 Bacteria 215502
67 Ga0265327_10001151 3300031251 Bacteria 36021
68 Ga0265327_10001462 3300031251 Bacteria 29625
69 Ga0316576_10312816 3300031727 Bacteria 1173
70 Ga0316578_10179516 3300031728 Bacteria 1276
71 Ga0316578_10436285 3300031728 Bacteria 775
72 Ga0307407_11111039 3300031903 Bacteria 615
73 Ga0307409_101948651 3300031995 Bacteria 617
74 Ga0307416_100177604 3300032002 Bacteria 1992
75 Ga0307411_11146773 3300032005 Bacteria 703
76 Ga0307415_100064666 3300032126 Bacteria 2546
77 Ga0307415_100724381 3300032126 Bacteria 900
78 Ga0373960_0110776 3300035121 Bacteria 900
79 Ga0316574_0230124 3300035398 Unclassified 1187
80 Ga0436365_1361318 3300039437 Bacteria 895
81 Ga0436361_0486395 3300039447 Bacteria 2089
82 Ga0436361_0622867 3300039447 Bacteria 679
83 Ga0436361_0714678 3300039447 Bacteria 717
84 Ga0436362_0132880 3300039453 Bacteria 1504
85 Ga0436362_0543069 3300039453 Bacteria 3309
86 Ga0439466_0112942 3300041411 Bacteria 842
87 Ga0439466_0183178 3300041411 Bacteria 638
88 Ga0439465_0014187 3300041413 Bacteria 2483
89 Ga0451791_0282548 3300041451 Bacteria 730
90 Ga0451795_1287765 3300041456 Bacteria 749
91 Ga0439445_0026555 3300042004 Bacteria 1483
92 Ga0439434_0151713 3300042435 Bacteria 767
93 Ga0466969_0013363 3300044656 Bacteria 4323
94 Ga0466969_0020033 3300044656 Bacteria 3467
95 Ga0466972_0011756 3300044658 Bacteria 4395
96 Ga0466965_0037423 3300044683 Bacteria 2382
97 Ga0466965_0590346 3300044683 Bacteria 630
98 Ga0466966_0008407 3300044684 Bacteria 6828
99 Ga0466966_0024853 3300044684 Bacteria 3918
100 Ga0466966_0047722 3300044684 Bacteria 2729
101 Ga0466961_0005701 3300044693 Bacteria 7877
102 Ga0466961_0057859 3300044693 Bacteria 2467
103 Ga0466971_0015646 3300044719 Bacteria 3341
104 Ga0466968_0013138 3300044735 Bacteria 3251
105 Ga0466970_0002304 3300044765 Bacteria 9231
106 Ga0466970_0021923 3300044765 Bacteria 3332
107 Ga0466970_0943554 3300044765 Bacteria 508
108 Ga0466957_0004113 3300044842 Bacteria 8062
109 Ga0466957_0005974 3300044842 Bacteria 6867
110 Ga0466959_0003108 3300045049 Bacteria 10762
111 Ga0466959_0005594 3300045049 Bacteria 8637
112 Ga0466959_0016419 3300045049 Bacteria 5409
113 Ga0466958_0000569 3300045836 Bacteria 15728
114 Ga0466958_0032014 3300045836 Bacteria 3126
115 Ga0466958_0035538 3300045836 Bacteria 2977
116 Ga0466967_0944192 3300045976 Bacteria 858
117 Ga0495580_0572957 3300046472 Bacteria 748
118 Ga0495628_0074012 3300046516 Bacteria 2654
119 Ga0495648_0000628 3300046524 Bacteria 37663
120 Ga0495667_0286474 3300046559 Bacteria 1045
121 Ga0495668_0019152 3300046616 Bacteria 3949
122 Ga0495611_0108617 3300046648 Bacteria 1290
123 Ga0495588_0095352 3300046674 Bacteria 1560
124 Ga0495646_0600953 3300046680 Unclassified 559
125 Ga0495624_0650207 3300046690 Unclassified 627
126 Ga0495581_0437025 3300047315 Bacteria 762
127 Ga0495680_0614337 3300047322 Unclassified 726
128 Ga0495673_0006507 3300047469 Bacteria 6856
129 Ga0495614_0343140 3300048089 Unclassified 695
130 Ga0496110_1072118 3300048913 Bacteria 714
131 Ga0496114_0067019 3300048917 Bacteria 3011
132 Ga0496120_0047878 3300048923 Bacteria 2463
133 Ga0496121_0101141 3300048924 Bacteria 2224
134 Ga0496125_0076117 3300048928 Bacteria 2593
135 Ga0496125_0176893 3300048928 Bacteria 1426
136 Ga0496126_0035891 3300048929 Bacteria 4640
137 Ga0501032_0017803 3300049569 Bacteria 4986
138 Ga0501034_0000540 3300049571 Bacteria 60149
139 Ga0501034_0026365 3300049571 Bacteria 5919
140 Ga0501034_0575043 3300049571 Bacteria 1034
141 Ga0501036_0397638 3300049572 Bacteria 1149
142 Ga0501037_0007367 3300049573 Bacteria 8049
143 Ga0501038_0086101 3300049574 Bacteria 2641
144 Ga0501039_0264176 3300049575 Bacteria 1353
145 Ga0501043_0192098 3300049579 Bacteria 1587
146 Ga0501047_0056990 3300049581 Bacteria 3779
147 Ga0501068_0004289 3300049584 Bacteria 7746
148 Ga0501070_0006075 3300049586 Bacteria 10290
149 Ga0501070_0017077 3300049586 Bacteria 6090
150 Ga0501070_0032950 3300049586 Bacteria 4334
151 Ga0501070_0202630 3300049586 Bacteria 1629
152 Ga0501072_0000157 3300049588 Bacteria 50687
153 Ga0501074_0005120 3300049590 Bacteria 9421
154 Ga0501074_0189135 3300049590 Bacteria 1468
155 Ga0501079_0919196 3300049741 Bacteria 689
156 Ga0501080_0006291 3300049742 Bacteria 10657
157 Ga0501083_0012528 3300049744 Bacteria 5933
158 Ga0501044_0121574 3300049823 Bacteria 2611
159 nmdc:mga03683_185633_c1 3300050489 Bacteria 950
160 nmdc:mga03683_274225_c1 3300050489 Bacteria 787
161 nmdc:mga00v17_132708_c1 3300050491 Bacteria 1592
162 nmdc:mga00v17_246599_c1 3300050491 Bacteria 1158
163 nmdc:mga00v17_482593_c1 3300050491 Bacteria 804
164 nmdc:mga0yw44_602_c1 3300050492 Bacteria 13009
165 nmdc:mga0yw44_77215_c1 3300050492 Bacteria 2080
166 nmdc:mga06z11_152206_c1 3300050494 Bacteria 1316
167 nmdc:mga04h51_98987_c1 3300050495 Bacteria 1060
168 nmdc:mga07m45_15799_c1 3300050496 Bacteria 1517
169 nmdc:mga07m45_34311_c1 3300050496 Bacteria 2820
170 nmdc:mga07m45_370792_c1 3300050496 Bacteria 831
171 nmdc:mga07m45_55743_c1 3300050496 Bacteria 2234
172 nmdc:mga07m45_62395_c1 3300050496 Bacteria 2112
173 nmdc:mga0sz30_123024_c1 3300050516 Bacteria 1141
174 nmdc:mga0sz30_6791_c1 3300050516 Bacteria 4270
175 nmdc:mga0sz30_95645_c1 3300050516 Bacteria 1295
176 Ga0495601_0371464 3300053077 Bacteria 929
177 Ga0500635_0001166 3300053080 Bacteria 6303
178 Ga0495619_0421052 3300053085 Bacteria 921
179 Ga0495619_0899688 3300053085 Bacteria 595
180 Ga0500641_0033885 3300053096 Bacteria 2030
181 Ga0500652_001491 3300053131 Bacteria 7204
182 Ga0500652_006343 3300053131 Bacteria 3803
183 Ga0500645_000006 3300053730 Bacteria 276677
184 Ga0466962_0022665 3300061719 Bacteria 3019
185 Ga0466962_0049622 3300061719 Bacteria 2006
186 2566991412 2565956761 Bacteria 6601618
187 2738888127 2738541308 Bacteria 7020677
188 2739203959 2738543005 Bacteria 5278128
189 2739238620 2738543011 Bacteria 5731169
190 2889303054 2889300758 Bacteria 5690814
191 2902798085 2902792274 Bacteria 7270173
192 2902799531 2902799365 Bacteria 5419524
193 2904538246 2904535858 Bacteria 6308016
194 2922557437 2922554459 Bacteria 6683962
195 2928145690 2928142448 Bacteria 5288925
196 2939746068 2939743619 Bacteria 5762299
197 Ga0496108_0116811
198 Ga0068869_100313510
199 Ga0070714_100219300
200 Ga0070714_100621005
201 Ga0070714_101076087
202 Ga0070713_100024355
203 Ga0070710_10131924
204 Ga0070711_101528943
205 Ga0070700_101564245
206 Ga0070663_101406452
207 Ga0070706_100806131
208 Ga0070707_101784854
209 Ga0070695_100903578
210 Ga0068854_100162246
211 Ga0068856_100100790
212 Ga0068856_100238773
213 Ga0068852_100120097
214 Ga0068858_100499467
215 Ga0081455_10194793
216 Ga0070717_11182385
217 Ga0075365_10086173
218 Ga0075368_10211811
219 Ga0075363_100068943
220 Ga0075363_100076253
221 Ga0075363_100285763
222 Ga0075363_100420188
223 Ga0075364_10002875
224 Ga0075364_10021911
225 Ga0075364_10299422
226 Ga0075364_10334861
227 Ga0070716_100260508
228 Ga0070712_100714727
229 Ga0075367_10189351
230 Ga0075369_10008229
231 Ga0075369_10022169
232 Ga0075370_10018959
233 Ga0075370_10056126
234 Ga0075370_10229908
235 Ga0075428_101551773
236 Ga0075436_100635450
237 Ga0075436_101120720
238 Ga0099795_10016936
239 Ga0105240_12014649
240 Ga0105245_10009288
241 Ga0105243_10000454
242 Ga0105241_10071585
243 Ga0105239_11265600
244 Ga0157369_10059265
245 Ga0163162_10094723
246 Ga0163161_10421294
247 Ga0213873_10166083
248 Ga0207692_10138518
249 Ga0207687_10027366
250 Ga0207664_10163034
251 Ga0207664_10925141
252 Ga0207709_10008738
253 Ga0207665_10276937
254 Ga0207667_10040384
255 Ga0207640_10181046
256 Ga0207703_10437281
257 Ga0207702_10079330
258 Ga0207702_10451820
259 Ga0207698_10657111
260 Ga0209179_1019095
261 Ga0265762_1047644
262 Ga0265327_10000071
263 Ga0265327_10001151
264 Ga0265327_10001462
265 Ga0316576_10312816
266 Ga0316578_10179516
267 Ga0316578_10436285
268 Ga0307407_11111039
269 Ga0307409_101948651
270 Ga0307416_100177604
271 Ga0307411_11146773
272 Ga0307415_100064666
273 Ga0307415_100724381
274 Ga0373960_0110776
275 Ga0316574_0230124
276 Ga0436365_1361318
277 Ga0436361_0486395
278 Ga0436361_0622867
279 Ga0436361_0714678
280 Ga0436362_0132880
281 Ga0436362_0543069
282 Ga0439466_0112942
283 Ga0439466_0183178
284 Ga0439465_0014187
285 Ga0451791_0282548
286 Ga0451795_1287765
287 Ga0439445_0026555
288 Ga0439434_0151713
289 Ga0466969_0013363
290 Ga0466969_0020033
291 Ga0466972_0011756
292 Ga0466965_0037423
293 Ga0466965_0590346
294 Ga0466966_0008407
295 Ga0466966_0024853
296 Ga0466966_0047722
297 Ga0466961_0005701
298 Ga0466961_0057859
299 Ga0466971_0015646
300 Ga0466968_0013138
301 Ga0466970_0002304
302 Ga0466970_0021923
303 Ga0466970_0943554
304 Ga0466957_0004113
305 Ga0466957_0005974
306 Ga0466959_0003108
307 Ga0466959_0005594
308 Ga0466959_0016419
309 Ga0466958_0000569
310 Ga0466958_0032014
311 Ga0466958_0035538
312 Ga0466967_0944192
313 Ga0495580_0572957
314 Ga0495628_0074012
315 Ga0495648_0000628
316 Ga0495667_0286474
317 Ga0495668_0019152
318 Ga0495611_0108617
319 Ga0495588_0095352
320 Ga0495646_0600953
321 Ga0495624_0650207
322 Ga0495581_0437025
323 Ga0495680_0614337
324 Ga0495673_0006507
325 Ga0495614_0343140
326 Ga0496110_1072118
327 Ga0496114_0067019
328 Ga0496120_0047878
329 Ga0496121_0101141
330 Ga0496125_0076117
331 Ga0496125_0176893
332 Ga0496126_0035891
333 Ga0501032_0017803
334 Ga0501034_0000540
335 Ga0501034_0026365
336 Ga0501034_0575043
337 Ga0501036_0397638
338 Ga0501037_0007367
339 Ga0501038_0086101
340 Ga0501039_0264176
341 Ga0501043_0192098
342 Ga0501047_0056990
343 Ga0501068_0004289
344 Ga0501070_0006075
345 Ga0501070_0017077
346 Ga0501070_0032950
347 Ga0501070_0202630
348 Ga0501072_0000157
349 Ga0501074_0005120
350 Ga0501074_0189135
351 Ga0501079_0919196
352 Ga0501080_0006291
353 Ga0501083_0012528
354 Ga0501044_0121574
355 nmdc:mga03683_185633_c1
356 nmdc:mga03683_274225_c1
357 nmdc:mga00v17_132708_c1
358 nmdc:mga00v17_246599_c1
359 nmdc:mga00v17_482593_c1
360 nmdc:mga0yw44_602_c1
361 nmdc:mga0yw44_77215_c1
362 nmdc:mga06z11_152206_c1
363 nmdc:mga04h51_98987_c1
364 nmdc:mga07m45_15799_c1
365 nmdc:mga07m45_34311_c1
366 nmdc:mga07m45_370792_c1
367 nmdc:mga07m45_55743_c1
368 nmdc:mga07m45_62395_c1
369 nmdc:mga0sz30_123024_c1
370 nmdc:mga0sz30_6791_c1
371 nmdc:mga0sz30_95645_c1
372 Ga0495601_0371464
373 Ga0500635_0001166
374 Ga0495619_0421052
375 Ga0495619_0899688
376 Ga0500641_0033885
377 Ga0500652_001491
378 Ga0500652_006343
379 Ga0500645_000006
380 Ga0466962_0022665
381 Ga0466962_0049622
382 2566991412
383 2738888127
384 2739203959
385 2739238620
386 2889303054
387 2902798085
388 2902799531
389 2904538246
390 2922557437
391 2928145690
392 2939746068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

17

107

0.9

PF13577

SnoaL_4

SnoaL-like domain

3

115

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pej-assembly1.cif.gz_A crystal structure of a computationally designed retro-aldolase, ra110.4 (cys free) 0.8103 4 133
6uae-assembly4.cif.gz_D ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8058 5 133
6f50-assembly2.cif.gz_B crystal structure of ketosteroid isomerase double variant v88i/l99v 0.8036 5 133
6tzd-assembly1.cif.gz_A crystal structure of ketosteroid isomerase from pseudomonas putida (pksi) bound to 4-androstenedione at 280 k 0.8031 1 133
4r9k-assembly1.cif.gz_A structure of thermostable eightfold mutant of limonene epoxide hydrolase from rhodococcus erythropolis 0.8022 9 139
ID Description Score Start End Superfamily
af_P96815_13_143_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.986 12 141 3.10.450.50
af_P96815_13_143_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9712 12 141 3.10.450.50
af_I6XW93_5_142_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8119 5 140 3.10.450.50
5jppA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7982 8 130 3.10.450.50
af_I6XW93_5_142_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7904 5 140 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A829MGK6-F1-model_v4 SnoaL-like domain protein 0.992 13 147
AF-A0A538J998-F1-model_v4 Nuclear transport factor 2 family protein 0.9892 5 148
AF-A0A370CRA0-F1-model_v4 deleted 0.9891 5 147
AF-A0A2E8GZU9-F1-model_v4 SnoaL-like domain-containing protein 0.9882 35 113
AF-A0A2S8LFD7-F1-model_v4 deleted 0.9874 5 147

Map