F301837

General Info

Members Datasets Scaffolds Average Seq Length
196 124 392 135

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0434924|Ga0373937_0434924_705_1112
Length 135
Sequence MFPFRPKYIPAVGPGKLSPRERVCAQWRGIDLTALEKARELRACRAGSVLPKVLADLGLERRRFDAEVVSVWKHLDPNIVAHAQPTGLRKGTLFVTVDSNVWLSEIVRYRRKEILDRLRHSFGPDLIARISFRVG

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
70 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
79 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
106 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
124 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 0
Rhizosphere 99.49
Stem 0
Stem Tuber 0
Unclassified 42.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0434924 3300036401 Unclassified 1246
2 Ga0065712_10333074 3300005290 Bacteria 811
3 Ga0065707_10166749 3300005295 Bacteria 1516
4 Ga0070658_10103401 3300005327 Bacteria 2355
5 Ga0070683_100132837 3300005329 Unclassified 2356
6 Ga0070683_100566512 3300005329 Bacteria 1086
7 Ga0070690_100108711 3300005330 Bacteria 1848
8 Ga0068869_100617418 3300005334 Unclassified 917
9 Ga0070689_100577985 3300005340 Unclassified 971
10 Ga0070675_100553946 3300005354 Unclassified 1040
11 Ga0070674_100223721 3300005356 Bacteria 1465
12 Ga0070688_100700146 3300005365 Unclassified 785
13 Ga0070688_101197282 3300005365 Unclassified 610
14 Ga0070688_101525695 3300005365 Archaea 544
15 Ga0070703_10182830 3300005406 Bacteria 811
16 Ga0070708_100047509 3300005445 Bacteria 3792
17 Ga0070681_10264549 3300005458 Bacteria 1631
18 Ga0068867_100573655 3300005459 Unclassified 980
19 Ga0070698_101287228 3300005471 Bacteria 681
20 Ga0070679_100362017 3300005530 Bacteria 1398
21 Ga0070679_101342713 3300005530 Bacteria 661
22 Ga0070684_100632054 3300005535 Unclassified 996
23 Ga0070684_101350681 3300005535 Bacteria 671
24 Ga0070672_100263740 3300005543 Bacteria 1453
25 Ga0070686_100086134 3300005544 Bacteria 2091
26 Ga0068855_100021654 3300005563 Bacteria 7711
27 Ga0068855_100232992 3300005563 Bacteria 2061
28 Ga0068855_100258564 3300005563 Bacteria 1940
29 Ga0068855_100342401 3300005563 Unclassified 1648
30 Ga0068856_100027440 3300005614 Bacteria 5555
31 Ga0068864_100156880 3300005618 Bacteria 2066
32 Ga0068863_100138298 3300005841 Bacteria 2327
33 Ga0068863_100519465 3300005841 Unclassified 1174
34 Ga0070712_100082805 3300006175 Bacteria 2328
35 Ga0070712_100204363 3300006175 Unclassified 1554
36 Ga0097621_100334102 3300006237 Unclassified 1345
37 Ga0097621_100581073 3300006237 Unclassified 1022
38 Ga0068871_100039355 3300006358 Bacteria 3783
39 Ga0068871_101141812 3300006358 Bacteria 729
40 Ga0075435_100801136 3300007076 Unclassified 820
41 Ga0075435_101394609 3300007076 Bacteria 614
42 Ga0105240_10332379 3300009093 Bacteria 1729
43 Ga0111539_10253108 3300009094 Bacteria 2051
44 Ga0111539_10607594 3300009094 Unclassified 1274
45 Ga0105245_12942463 3300009098 Unclassified 528
46 Ga0114129_11399336 3300009147 Unclassified 863
47 Ga0105242_10163302 3300009176 Bacteria 1951
48 Ga0105242_13331699 3300009176 Unclassified 500
49 Ga0105248_12575051 3300009177 Unclassified 580
50 Ga0105237_10256791 3300009545 Bacteria 1750
51 Ga0105238_10012977 3300009551 Bacteria 8410
52 Ga0105238_10873535 3300009551 Unclassified 917
53 Ga0157370_10044472 3300013104 Bacteria 4267
54 Ga0157370_10692244 3300013104 Unclassified 930
55 Ga0157369_10422739 3300013105 Unclassified 1381
56 Ga0157374_10136417 3300013296 Unclassified 2379
57 Ga0157374_10603956 3300013296 Unclassified 1107
58 Ga0157378_10338494 3300013297 Bacteria 1466
59 Ga0157378_12155878 3300013297 Unclassified 608
60 Ga0157378_12417721 3300013297 Unclassified 577
61 Ga0163162_10991148 3300013306 Unclassified 950
62 Ga0157372_10290603 3300013307 Bacteria 1901
63 Ga0157375_10000086 3300013308 Bacteria 93377
64 Ga0157375_10660562 3300013308 Unclassified 1201
65 Ga0163163_10000010 3300014325 Bacteria 264773
66 Ga0163163_12960817 3300014325 Unclassified 530
67 Ga0157376_10131528 3300014969 Bacteria 2233
68 Ga0157376_10504960 3300014969 Unclassified 1189
69 Ga0206356_11271888 3300020070 Unclassified 529
70 Ga0207688_10353179 3300025901 Unclassified 906
71 Ga0207680_10179061 3300025903 Bacteria 1432
72 Ga0207705_10377755 3300025909 Unclassified 1094
73 Ga0207707_10113005 3300025912 Bacteria 2374
74 Ga0207707_10527270 3300025912 Unclassified 1005
75 Ga0207695_10076270 3300025913 Bacteria 3408
76 Ga0207695_10234803 3300025913 Bacteria 1737
77 Ga0207695_10596129 3300025913 Unclassified 986
78 Ga0207671_10223893 3300025914 Bacteria 1474
79 Ga0207657_10216364 3300025919 Bacteria 1536
80 Ga0207652_10217880 3300025921 Unclassified 1720
81 Ga0207652_10661459 3300025921 Unclassified 934
82 Ga0207694_10016501 3300025924 Bacteria 5577
83 Ga0207694_10752247 3300025924 Unclassified 823
84 Ga0207687_11705586 3300025927 Unclassified 540
85 Ga0207700_10021339 3300025928 Unclassified 4420
86 Ga0207700_10696598 3300025928 Bacteria 907
87 Ga0207664_10080154 3300025929 Bacteria 2653
88 Ga0207686_10594230 3300025934 Unclassified 870
89 Ga0207670_10014509 3300025936 Bacteria 4680
90 Ga0207691_10284133 3300025940 Bacteria 1423
91 Ga0207661_10306491 3300025944 Bacteria 1425
92 Ga0207667_10050884 3300025949 Bacteria 4370
93 Ga0207667_10218571 3300025949 Bacteria 1953
94 Ga0207667_10225800 3300025949 Bacteria 1918
95 Ga0207667_10707172 3300025949 Unclassified 1010
96 Ga0207639_10737513 3300026041 Bacteria 915
97 Ga0207702_10022224 3300026078 Bacteria 5258
98 Ga0207702_10814060 3300026078 Unclassified 923
99 Ga0207641_10263002 3300026088 Unclassified 1616
100 Ga0207641_10337932 3300026088 Unclassified 1432
101 Ga0207641_11683016 3300026088 Unclassified 636
102 Ga0207676_10526372 3300026095 Unclassified 1126
103 Ga0207674_10018404 3300026116 Bacteria 7594
104 Ga0207674_11535696 3300026116 Bacteria 635
105 Ga0265326_10127570 3300028558 Unclassified 724
106 Ga0265319_1051633 3300028563 Unclassified 1355
107 Ga0265334_10044448 3300028573 Bacteria 1725
108 Ga0265334_10115934 3300028573 Bacteria 960
109 Ga0265338_10007105 3300028800 Bacteria 14027
110 Ga0265338_10048664 3300028800 Unclassified 3854
111 Ga0265338_10051981 3300028800 Bacteria 3683
112 Ga0265338_10097502 3300028800 Bacteria 2408
113 Ga0265338_10129269 3300028800 Unclassified 1998
114 Ga0265338_10258202 3300028800 Bacteria 1282
115 Ga0265324_10015561 3300029957 Unclassified 2794
116 Ga0265324_10113989 3300029957 Bacteria 918
117 Ga0265324_10179807 3300029957 Unclassified 718
118 Ga0265332_10205936 3300031238 Unclassified 817
119 Ga0265320_10082776 3300031240 Bacteria 1496
120 Ga0265316_10361370 3300031344 Unclassified 1050
121 Ga0265316_10517722 3300031344 Unclassified 851
122 Ga0265342_10084959 3300031712 Bacteria 1822
123 Ga0265342_10386847 3300031712 Unclassified 724
124 Ga0316576_10054463 3300031727 Unclassified 2918
125 Ga0316577_10074259 3300031733 Bacteria 1899
126 Ga0307412_10844583 3300031911 Unclassified 798
127 Ga0307412_11754731 3300031911 Unclassified 570
128 Ga0373936_0423128 3300035113 Unclassified 613
129 Ga0373937_1940891 3300036401 Bacteria 535
130 Ga0316584_0106068 3300036712 Bacteria 2103
131 Ga0373925_0178556 3300037068 Unclassified 1679
132 Ga0453684_0140209 3300044712 Bacteria 2888
133 Ga0451576_0007509 3300045051 Bacteria 13012
134 Ga0451576_0073740 3300045051 Bacteria 3552
135 Ga0451576_0133317 3300045051 Unclassified 2590
136 Ga0451576_0153842 3300045051 Bacteria 2399
137 Ga0451576_0295594 3300045051 Unclassified 1693
138 Ga0451576_0401336 3300045051 Bacteria 1437
139 Ga0451576_2687568 3300045051 Unclassified 507
140 Ga0495592_0000127 3300046454 Bacteria 67688
141 Ga0495592_0156496 3300046454 Bacteria 1571
142 Ga0495629_0435046 3300046459 Bacteria 889
143 Ga0495651_0198337 3300046462 Bacteria 1407
144 Ga0495582_0314858 3300046473 Bacteria 900
145 Ga0495662_0168317 3300046476 Bacteria 1080
146 Ga0495662_0362691 3300046476 Bacteria 712
147 Ga0495664_0383659 3300046477 Unclassified 845
148 Ga0495608_0524971 3300046511 Bacteria 715
149 Ga0495618_0002211 3300046514 Bacteria 12701
150 Ga0495618_0113365 3300046514 Unclassified 1736
151 Ga0495628_0000691 3300046516 Bacteria 31126
152 Ga0495628_0572962 3300046516 Unclassified 809
153 Ga0495630_0000036 3300046517 Bacteria 116547
154 Ga0495630_0005795 3300046517 Bacteria 8729
155 Ga0495666_0024695 3300046526 Unclassified 2968
156 Ga0495652_0029742 3300046529 Unclassified 4796
157 Ga0495652_0037384 3300046529 Bacteria 4212
158 Ga0495640_0008499 3300046533 Bacteria 8049
159 Ga0495586_0000162 3300046535 Bacteria 43397
160 Ga0495586_0000319 3300046535 Bacteria 30458
161 Ga0495586_0127338 3300046535 Bacteria 1425
162 Ga0495587_0225669 3300046536 Bacteria 1056
163 Ga0495645_0002269 3300046543 Bacteria 13086
164 Ga0495645_0004735 3300046543 Bacteria 9300
165 Ga0495667_0126116 3300046559 Bacteria 1652
166 Ga0495667_0860757 3300046559 Unclassified 557
167 Ga0495634_0035365 3300046642 Unclassified 3422
168 Ga0495599_0005573 3300046678 Bacteria 7555
169 Ga0495646_0553563 3300046680 Unclassified 587
170 Ga0495647_0041046 3300046681 Unclassified 1761
171 Ga0495647_0171282 3300046681 Unclassified 940
172 Ga0495658_0099059 3300046683 Unclassified 1737
173 Ga0495658_0229828 3300046683 Bacteria 1163
174 Ga0495613_0227908 3300046689 Bacteria 1306
175 Ga0495624_0416362 3300046690 Bacteria 806
176 Ga0495581_0078617 3300047315 Bacteria 1909
177 Ga0495581_0334989 3300047315 Bacteria 883
178 Ga0495604_0460722 3300047317 Bacteria 829
179 Ga0495674_0004564 3300047319 Bacteria 13319
180 Ga0495674_0018052 3300047319 Bacteria 6568
181 Ga0495674_0113611 3300047319 Bacteria 2294
182 Ga0495676_0035344 3300047321 Bacteria 4181
183 Ga0495675_0227835 3300047444 Bacteria 1126
184 Ga0495675_0257472 3300047444 Bacteria 1046
185 Ga0495684_0401467 3300047471 Unclassified 962
186 Ga0495602_0733810 3300048088 Unclassified 668
187 Ga0495614_0229704 3300048089 Unclassified 845
188 Ga0495614_0576129 3300048089 Unclassified 539
189 Ga0501043_1006847 3300049579 Bacteria 593
190 Ga0501242_068328 3300049674 Unclassified 552
191 Ga0501035_0215392 3300049822 Bacteria 1642
192 nmdc:mga05p37_1607017_c1 3300050507 Unclassified 640
193 nmdc:mga08y16_152779_c2 3300050511 Bacteria 2092
194 nmdc:mga08y16_440188_c1 3300050511 Bacteria 1330
195 Ga0495601_0160449 3300053077 Bacteria 1469
196 Ga0500595_048921 3300053119 Bacteria 1319
197 Ga0373937_0434924
198 Ga0065712_10333074
199 Ga0065707_10166749
200 Ga0070658_10103401
201 Ga0070683_100132837
202 Ga0070683_100566512
203 Ga0070690_100108711
204 Ga0068869_100617418
205 Ga0070689_100577985
206 Ga0070675_100553946
207 Ga0070674_100223721
208 Ga0070688_100700146
209 Ga0070688_101197282
210 Ga0070688_101525695
211 Ga0070703_10182830
212 Ga0070708_100047509
213 Ga0070681_10264549
214 Ga0068867_100573655
215 Ga0070698_101287228
216 Ga0070679_100362017
217 Ga0070679_101342713
218 Ga0070684_100632054
219 Ga0070684_101350681
220 Ga0070672_100263740
221 Ga0070686_100086134
222 Ga0068855_100021654
223 Ga0068855_100232992
224 Ga0068855_100258564
225 Ga0068855_100342401
226 Ga0068856_100027440
227 Ga0068864_100156880
228 Ga0068863_100138298
229 Ga0068863_100519465
230 Ga0070712_100082805
231 Ga0070712_100204363
232 Ga0097621_100334102
233 Ga0097621_100581073
234 Ga0068871_100039355
235 Ga0068871_101141812
236 Ga0075435_100801136
237 Ga0075435_101394609
238 Ga0105240_10332379
239 Ga0111539_10253108
240 Ga0111539_10607594
241 Ga0105245_12942463
242 Ga0114129_11399336
243 Ga0105242_10163302
244 Ga0105242_13331699
245 Ga0105248_12575051
246 Ga0105237_10256791
247 Ga0105238_10012977
248 Ga0105238_10873535
249 Ga0157370_10044472
250 Ga0157370_10692244
251 Ga0157369_10422739
252 Ga0157374_10136417
253 Ga0157374_10603956
254 Ga0157378_10338494
255 Ga0157378_12155878
256 Ga0157378_12417721
257 Ga0163162_10991148
258 Ga0157372_10290603
259 Ga0157375_10000086
260 Ga0157375_10660562
261 Ga0163163_10000010
262 Ga0163163_12960817
263 Ga0157376_10131528
264 Ga0157376_10504960
265 Ga0206356_11271888
266 Ga0207688_10353179
267 Ga0207680_10179061
268 Ga0207705_10377755
269 Ga0207707_10113005
270 Ga0207707_10527270
271 Ga0207695_10076270
272 Ga0207695_10234803
273 Ga0207695_10596129
274 Ga0207671_10223893
275 Ga0207657_10216364
276 Ga0207652_10217880
277 Ga0207652_10661459
278 Ga0207694_10016501
279 Ga0207694_10752247
280 Ga0207687_11705586
281 Ga0207700_10021339
282 Ga0207700_10696598
283 Ga0207664_10080154
284 Ga0207686_10594230
285 Ga0207670_10014509
286 Ga0207691_10284133
287 Ga0207661_10306491
288 Ga0207667_10050884
289 Ga0207667_10218571
290 Ga0207667_10225800
291 Ga0207667_10707172
292 Ga0207639_10737513
293 Ga0207702_10022224
294 Ga0207702_10814060
295 Ga0207641_10263002
296 Ga0207641_10337932
297 Ga0207641_11683016
298 Ga0207676_10526372
299 Ga0207674_10018404
300 Ga0207674_11535696
301 Ga0265326_10127570
302 Ga0265319_1051633
303 Ga0265334_10044448
304 Ga0265334_10115934
305 Ga0265338_10007105
306 Ga0265338_10048664
307 Ga0265338_10051981
308 Ga0265338_10097502
309 Ga0265338_10129269
310 Ga0265338_10258202
311 Ga0265324_10015561
312 Ga0265324_10113989
313 Ga0265324_10179807
314 Ga0265332_10205936
315 Ga0265320_10082776
316 Ga0265316_10361370
317 Ga0265316_10517722
318 Ga0265342_10084959
319 Ga0265342_10386847
320 Ga0316576_10054463
321 Ga0316577_10074259
322 Ga0307412_10844583
323 Ga0307412_11754731
324 Ga0373936_0423128
325 Ga0373937_1940891
326 Ga0316584_0106068
327 Ga0373925_0178556
328 Ga0453684_0140209
329 Ga0451576_0007509
330 Ga0451576_0073740
331 Ga0451576_0133317
332 Ga0451576_0153842
333 Ga0451576_0295594
334 Ga0451576_0401336
335 Ga0451576_2687568
336 Ga0495592_0000127
337 Ga0495592_0156496
338 Ga0495629_0435046
339 Ga0495651_0198337
340 Ga0495582_0314858
341 Ga0495662_0168317
342 Ga0495662_0362691
343 Ga0495664_0383659
344 Ga0495608_0524971
345 Ga0495618_0002211
346 Ga0495618_0113365
347 Ga0495628_0000691
348 Ga0495628_0572962
349 Ga0495630_0000036
350 Ga0495630_0005795
351 Ga0495666_0024695
352 Ga0495652_0029742
353 Ga0495652_0037384
354 Ga0495640_0008499
355 Ga0495586_0000162
356 Ga0495586_0000319
357 Ga0495586_0127338
358 Ga0495587_0225669
359 Ga0495645_0002269
360 Ga0495645_0004735
361 Ga0495667_0126116
362 Ga0495667_0860757
363 Ga0495634_0035365
364 Ga0495599_0005573
365 Ga0495646_0553563
366 Ga0495647_0041046
367 Ga0495647_0171282
368 Ga0495658_0099059
369 Ga0495658_0229828
370 Ga0495613_0227908
371 Ga0495624_0416362
372 Ga0495581_0078617
373 Ga0495581_0334989
374 Ga0495604_0460722
375 Ga0495674_0004564
376 Ga0495674_0018052
377 Ga0495674_0113611
378 Ga0495676_0035344
379 Ga0495675_0227835
380 Ga0495675_0257472
381 Ga0495684_0401467
382 Ga0495602_0733810
383 Ga0495614_0229704
384 Ga0495614_0576129
385 Ga0501043_1006847
386 Ga0501242_068328
387 Ga0501035_0215392
388 nmdc:mga05p37_1607017_c1
389 nmdc:mga08y16_152779_c2
390 nmdc:mga08y16_440188_c1
391 Ga0495601_0160449
392 Ga0500595_048921

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05258

DciA

Dna[CI] antecedent, DciA

45

132

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.8123 66 136
2m5o-assembly1.cif.gz_A solution nmr structure ctd domain of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876c 0.7585 66 134
8a3v-assembly1.cif.gz_C crystal structure of the vibrio cholerae replicative helicase (vcdnab) in complex with its loader protein (vcdcia) 0.7439 45 136
7po0-assembly1.cif.gz_a assembly intermediate of human mitochondrial ribosome small subunit without ms37 in complex with rbfa and if3 0.7265 55 136
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.7181 66 136
ID Description Score Start End Superfamily
2m5oA01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7585 66 134 3.30.300.130
af_P9WFL1_75_162_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.7231 47 132 3.30.300.180
2z51A01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7065 65 134 3.30.300.130
2m5oA01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.6979 66 134 3.30.300.130
2dyjB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.695 61 135 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A382EA04-F1-model_v4 DUF721 domain-containing protein 0.919 57 136
AF-A0A382EA04-F1-model_v4 DUF721 domain-containing protein 0.9083 57 136
AF-A0A2V5QP05-F1-model_v4 DUF721 domain-containing protein 0.8974 61 136
AF-A0A2V5XT74-F1-model_v4 DUF721 domain-containing protein 0.894 65 136
AF-A0A2D8Z7I3-F1-model_v4 DUF721 domain-containing protein 0.8859 65 136

Map