F301755

General Info

Members Datasets Scaffolds Average Seq Length
196 139 172 495

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000525|Ga0265327_100005252
Length 535
Sequence MGLAYKHRGERTYQDGADAPSGTTDLSRIETTDTQEPPRLPFGPAPLPPQEVDPADRRGPMRPDHLSPTRSRLQGWTLAMIFRAGDLAGVAITSLVIGLSGWPDGDWGDTSGLMIPLVAGAVLLWSLGATRAYALGHSEGLGRHLVRVGAGFGLTAVILAGLVTAFKPAADSATGLALWFCVAFVALYGLHTLWWLRVRRWRRDGRLTPNIVVVGATPGAQRLIESALRTQEVAVLGVFDDRLDRAPKRIEGVPVLGDTDALLGHRIMPFVDRVVIAVPSLARSRISQLVQRLSVLPNDVMLLVDYDNVEGRTAALSRLADAPLAQMAGQPGDERRALVKRLQDLVIGAIALVVFTPVFLAVAIAIKLDSPGPVFFRQRRHGFNNEQILVWKFRSMKVEATDATASRQVTADDERVTRVGRFIRKTSLDELPQLLNVLKGEMSLVGPRPHAVGMKTGETESARLVAEYAHRHRMKPGMTGWAAIKGSRGPVDTPELVRRRVALDIEYIERQSFWRDLYIMAMTIPCLLGDVKAVR

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
11 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
16 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
17 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
18 2818991435 Caulobacter henricii 536 Isolate Unclassified
19 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
20 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
21 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
22 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
23 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
24 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
91 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
99 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
100 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
112 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
125 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
126 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
129 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
130 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
131 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
132 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
133 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
134 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
135 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
136 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
137 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
138 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
139 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.76
Metatranscriptomes 0
Isolates 12.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.96
Nodule 0
Rhizoplane 1.53
Rhizosphere 60.2
Stem 0
Stem Tuber 0
Unclassified 15.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055537_1001703 3300003773 Bacteria 8142
2 Ga0055524_1017856 3300003775 Bacteria 2486
3 Ga0055536_1001215 3300003781 Bacteria 15974
4 Ga0055536_1001534 3300003781 Bacteria 13851
5 Ga0055531_10001669 3300003794 Bacteria 15983
6 Ga0055531_10009626 3300003794 Bacteria 4918
7 Ga0055531_10012978 3300003794 Bacteria 3877
8 Ga0055531_10012982 3300003794 Bacteria 3876
9 Ga0055531_10012986 3300003794 Bacteria 3875
10 Ga0065165_1001578 3300005262 Bacteria 23475
11 Ga0070670_100060193 3300005331 Bacteria 3260
12 Ga0070680_100000692 3300005336 Bacteria 23396
13 Ga0070660_100022090 3300005339 Bacteria 4701
14 Ga0070668_100005449 3300005347 Bacteria 9447
15 Ga0070668_100007568 3300005347 Bacteria 8061
16 Ga0070659_100000272 3300005366 Bacteria 40405
17 Ga0070659_100001005 3300005366 Bacteria 20712
18 Ga0070679_100006735 3300005530 Bacteria 10716
19 Ga0068853_100008105 3300005539 Bacteria 8432
20 Ga0070665_100000015 3300005548 Bacteria 462744
21 Ga0070665_100180173 3300005548 Bacteria 2114
22 Ga0068855_100013851 3300005563 Bacteria 9723
23 Ga0068855_100038361 3300005563 Bacteria 5692
24 Ga0068855_100102103 3300005563 Bacteria 3301
25 Ga0068856_100156539 3300005614 Bacteria 2289
26 Ga0068864_100002565 3300005618 Bacteria 14997
27 Ga0068863_100000470 3300005841 Bacteria 41201
28 Ga0068858_100000240 3300005842 Bacteria 59201
29 Ga0068860_100000396 3300005843 Bacteria 57011
30 Ga0068862_100013802 3300005844 Bacteria 6696
31 Ga0075369_10002462 3300006186 Bacteria 6606
32 Ga0105240_10002488 3300009093 Bacteria 29597
33 Ga0105240_10010514 3300009093 Bacteria 13004
34 Ga0105240_10018673 3300009093 Bacteria 9291
35 Ga0105248_10099088 3300009177 Bacteria 3284
36 Ga0105238_10074685 3300009551 Bacteria 3383
37 Ga0105238_10094699 3300009551 Bacteria 2974
38 Ga0157369_10072468 3300013105 Bacteria 3697
39 Ga0213876_10000414 3300021384 Bacteria 35795
40 Ga0209565_1000195 3300025263 Bacteria 72860
41 Ga0209673_1005936 3300025273 Bacteria 6026
42 Ga0209676_1000691 3300025292 Bacteria 47509
43 Ga0209676_1001404 3300025292 Bacteria 23284
44 Ga0209564_1001401 3300025295 Bacteria 25023
45 Ga0209758_1000919 3300025297 Bacteria 39837
46 Ga0209758_1002640 3300025297 Bacteria 17770
47 Ga0209050_1001227 3300025298 Bacteria 29766
48 Ga0209050_1002310 3300025298 Bacteria 16772
49 Ga0209256_1007158 3300025299 Bacteria 5615
50 Ga0209256_1013181 3300025299 Bacteria 3088
51 Ga0209051_1003674 3300025303 Bacteria 9927
52 Ga0209257_1000187 3300025304 Bacteria 154077
53 Ga0209257_1001622 3300025304 Bacteria 25777
54 Ga0209257_1006384 3300025304 Bacteria 7629
55 Ga0207705_10002979 3300025909 Bacteria 12929
56 Ga0207695_10006232 3300025913 Bacteria 15534
57 Ga0207695_10008945 3300025913 Bacteria 12465
58 Ga0207660_10001090 3300025917 Bacteria 18108
59 Ga0207657_10010351 3300025919 Bacteria 9307
60 Ga0207652_10003036 3300025921 Bacteria 13994
61 Ga0207652_10089213 3300025921 Bacteria 2707
62 Ga0207694_10022369 3300025924 Bacteria 4795
63 Ga0207694_10058550 3300025924 Bacteria 2996
64 Ga0207690_10000111 3300025932 Bacteria 66639
65 Ga0207690_10001855 3300025932 Bacteria 12992
66 Ga0207704_10003647 3300025938 Bacteria 6996
67 Ga0207711_10009151 3300025941 Bacteria 8274
68 Ga0207667_10005266 3300025949 Bacteria 15779
69 Ga0207667_10057901 3300025949 Bacteria 4066
70 Ga0207667_10069235 3300025949 Bacteria 3673
71 Ga0207703_10000079 3300026035 Bacteria 112451
72 Ga0207702_10185446 3300026078 Bacteria 1918
73 Ga0207641_10000034 3300026088 Bacteria 217752
74 Ga0207676_10000103 3300026095 Bacteria 76865
75 Ga0268266_10000005 3300028379 Bacteria 1448194
76 Ga0268265_10000966 3300028380 Bacteria 26398
77 Ga0268265_10021085 3300028380 Bacteria 4559
78 Ga0268264_10000169 3300028381 Bacteria 144978
79 Ga0307515_10093590 3300028794 Bacteria 3724
80 Ga0307515_10139025 3300028794 Bacteria 2617
81 Ga0265338_10014501 3300028800 Bacteria 8769
82 Ga0265338_10021783 3300028800 Bacteria 6662
83 Ga0265327_10000525 3300031251 Bacteria 66250
84 Ga0265327_10004906 3300031251 Bacteria 11548
85 Ga0307513_10000162 3300031456 Bacteria 96000
86 Ga0307513_10019491 3300031456 Bacteria 8076
87 Ga0265314_10031999 3300031711 Bacteria 3876
88 Ga0307516_10000154 3300031730 Bacteria 85753
89 Ga0307413_10057859 3300031824 Bacteria 2373
90 Ga0395899_0000178 3300037312 Bacteria 93671
91 Ga0395900_0000006 3300037418 Bacteria 495364
92 Ga0395898_0001323 3300037466 Bacteria 35937
93 Ga0436364_1457093 3300037853 Bacteria 1803
94 Ga0395901_0000001 3300038443 Bacteria 800383
95 Ga0436365_0197954 3300039437 Bacteria 9546
96 Ga0436365_1777519 3300039437 Bacteria 5683
97 Ga0436365_1830840 3300039437 Bacteria 45078
98 Ga0495627_000627 3300046453 Bacteria 28016
99 Ga0495590_0012149 3300046457 Bacteria 3202
100 Ga0495638_0000360 3300046460 Bacteria 56554
101 Ga0495638_0001868 3300046460 Bacteria 18222
102 Ga0495638_0002007 3300046460 Bacteria 17382
103 Ga0495638_0034084 3300046460 Bacteria 3252
104 Ga0495650_0000030 3300046471 Bacteria 436318
105 Ga0495594_0038590 3300046499 Bacteria 2609
106 Ga0495583_0000002 3300046506 Bacteria 782521
107 Ga0495606_0026340 3300046507 Bacteria 4145
108 Ga0495606_0058872 3300046507 Bacteria 2467
109 Ga0495610_0000091 3300046512 Bacteria 105916
110 Ga0495610_0002170 3300046512 Bacteria 16680
111 Ga0495610_0003799 3300046512 Bacteria 11516
112 Ga0495616_0000206 3300046513 Bacteria 49005
113 Ga0495616_0030336 3300046513 Bacteria 2843
114 Ga0495631_0006715 3300046518 Bacteria 5907
115 Ga0495632_0000727 3300046519 Bacteria 29842
116 Ga0495632_0029052 3300046519 Bacteria 2882
117 Ga0495632_0067194 3300046519 Bacteria 1729
118 Ga0495648_0001795 3300046524 Bacteria 20653
119 Ga0495654_0000120 3300046530 Bacteria 87369
120 Ga0495597_0048262 3300046542 Bacteria 1884
121 Ga0495633_0007054 3300046558 Bacteria 6542
122 Ga0495668_0000703 3300046616 Bacteria 40297
123 Ga0495668_0011886 3300046616 Bacteria 5188
124 Ga0495668_0070853 3300046616 Bacteria 1916
125 Ga0495625_0000058 3300046660 Bacteria 180863
126 Ga0495625_0000519 3300046660 Bacteria 56854
127 Ga0495625_0004483 3300046660 Bacteria 13185
128 Ga0495625_0008285 3300046660 Bacteria 8884
129 Ga0495625_0008713 3300046660 Bacteria 8601
130 Ga0495625_0073650 3300046660 Bacteria 2393
131 Ga0495625_0097793 3300046660 Bacteria 2019
132 Ga0495669_0000054 3300046684 Bacteria 78606
133 Ga0495669_0000716 3300046684 Bacteria 14409
134 Ga0495649_0003634 3300046694 Bacteria 10290
135 Ga0495589_0005320 3300046794 Bacteria 6797
136 Ga0495672_0004323 3300047320 Bacteria 11702
137 Ga0495679_006763 3300047446 Bacteria 4883
138 Ga0495673_0000225 3300047469 Bacteria 83589
139 Ga0495673_0000605 3300047469 Bacteria 35710
140 Ga0495673_0003491 3300047469 Bacteria 10341
141 Ga0495686_0000449 3300047472 Bacteria 62252
142 Ga0495686_0007226 3300047472 Bacteria 8362
143 Ga0495686_0044368 3300047472 Bacteria 2815
144 Ga0496101_0040106 3300048904 Bacteria 3335
145 Ga0496107_0000058 3300048910 Bacteria 54924
146 Ga0496115_0000536 3300048918 Bacteria 29579
147 Ga0496121_0026594 3300048924 Bacteria 5445
148 Ga0496122_0004284 3300048925 Bacteria 17885
149 Ga0496123_0001323 3300048926 Bacteria 34986
150 Ga0496124_0010531 3300048927 Bacteria 9352
151 Ga0496126_0005735 3300048929 Bacteria 14054
152 Ga0495678_000483 3300049459 Bacteria 39595
153 Ga0501044_0273282 3300049823 Bacteria 1625
154 nmdc:mga0sz30_4308_c1 3300050516 Bacteria 5135
155 Ga0500578_0000043 3300053086 Bacteria 128295
156 Ga0500643_000390 3300053087 Bacteria 33990
157 Ga0500644_0000012 3300053088 Bacteria 117525
158 Ga0500554_000939 3300053102 Bacteria 5679
159 Ga0500556_0000913 3300053104 Bacteria 16289
160 Ga0500556_0041997 3300053104 Bacteria 1615
161 Ga0500562_014564 3300053108 Bacteria 2013
162 Ga0500594_0000030 3300053118 Bacteria 47305
163 Ga0500595_016064 3300053119 Bacteria 2795
164 Ga0500608_000006 3300053122 Bacteria 102722
165 Ga0500618_000064 3300053125 Bacteria 91120
166 Ga0500658_0019550 3300053134 Bacteria 2549
167 Ga0500559_0000056 3300053136 Bacteria 88545
168 Ga0500559_0010348 3300053136 Bacteria 4008
169 Ga0500564_000150 3300053138 Bacteria 18072
170 Ga0500577_0001578 3300053142 Bacteria 5833
171 Ga0500622_0000248 3300053156 Bacteria 54726
172 Ga0500622_0002104 3300053156 Bacteria 14838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0038590 Ga0495594_0038590_1178_2581 424
2 3300021384 Ga0213876_10000414 Ga0213876_100004142 435
3 iso_pu_bacteria 2928531327 2928534433 436
4 3300025924 Ga0207694_10022369 Ga0207694_100223692 439
5 3300053108 Ga0500562_014564 Ga0500562_014564_45_1394 440
6 3300009551 Ga0105238_10094699 Ga0105238_100946992 441
7 3300046684 Ga0495669_0000716 Ga0495669_0000716_2827_4179 445
8 3300005548 Ga0070665_100180173 Ga0070665_1001801731 451
9 3300053122 Ga0500608_000006 Ga0500608_000006_89096_90469 451
10 3300053104 Ga0500556_0041997 Ga0500556_0041997_184_1569 452
11 3300046512 Ga0495610_0003799 Ga0495610_0003799_871_2436 453
12 3300053136 Ga0500559_0010348 Ga0500559_0010348_2614_3975 453
13 3300025921 Ga0207652_10089213 Ga0207652_100892131 455
14 3300005347 Ga0070668_100007568 Ga0070668_1000075687 456
15 3300005548 Ga0070665_100000015 Ga0070665_100000015140 460
16 3300028379 Ga0268266_10000005 Ga0268266_10000005977 460
17 3300005331 Ga0070670_100060193 Ga0070670_1000601933 461
18 3300048925 Ga0496122_0004284 Ga0496122_0004284_13152_14636 463
19 3300048926 Ga0496123_0001323 Ga0496123_0001323_8778_10262 463
20 3300025938 Ga0207704_10003647 Ga0207704_100036478 466
21 3300031251 Ga0265327_10004906 Ga0265327_100049062 467
22 3300003781 Ga0055536_1001215 Ga0055536_100121516 468
23 3300003794 Ga0055531_10001669 Ga0055531_1000166916 468
24 3300003794 Ga0055531_10012978 Ga0055531_100129781 468
25 3300003794 Ga0055531_10012982 Ga0055531_100129823 468
26 3300003794 Ga0055531_10012986 Ga0055531_100129861 468
27 3300025292 Ga0209676_1001404 Ga0209676_10014042 468
28 3300025298 Ga0209050_1001227 Ga0209050_100122726 468
29 3300025304 Ga0209257_1001622 Ga0209257_10016226 468
30 3300039437 Ga0436365_0197954 Ga0436365_0197954_7569_9044 469
31 3300053119 Ga0500595_016064 Ga0500595_016064_796_2229 469
32 3300039437 Ga0436365_1830840 Ga0436365_1830840_320_1849 470
33 3300028800 Ga0265338_10014501 Ga0265338_100145017 471
34 3300005336 Ga0070680_100000692 Ga0070680_10000069216 472
35 3300005366 Ga0070659_100001005 Ga0070659_10000100514 472
36 3300005530 Ga0070679_100006735 Ga0070679_1000067354 472
37 3300053156 Ga0500622_0002104 Ga0500622_0002104_9827_11350 472
38 3300049823 Ga0501044_0273282 Ga0501044_0273282_99_1592 473
39 3300046453 Ga0495627_000627 Ga0495627_000627_9404_10924 475
40 3300037853 Ga0436364_1457093 Ga0436364_1457093_32_1546 476
41 3300005563 Ga0068855_100038361 Ga0068855_1000383612 477
42 3300025949 Ga0207667_10069235 Ga0207667_100692354 477
43 3300005339 Ga0070660_100022090 Ga0070660_1000220902 478
44 3300005347 Ga0070668_100005449 Ga0070668_1000054495 478
45 3300005539 Ga0068853_100008105 Ga0068853_1000081055 478
46 3300005563 Ga0068855_100013851 Ga0068855_1000138518 478
47 3300005563 Ga0068855_100102103 Ga0068855_1001021032 478
48 3300005844 Ga0068862_100013802 Ga0068862_1000138025 478
49 3300025909 Ga0207705_10002979 Ga0207705_1000297911 478
50 3300025917 Ga0207660_10001090 Ga0207660_100010909 478
51 3300025919 Ga0207657_10010351 Ga0207657_100103515 478
52 3300025921 Ga0207652_10003036 Ga0207652_100030367 478
53 3300025932 Ga0207690_10001855 Ga0207690_100018558 478
54 3300025949 Ga0207667_10005266 Ga0207667_100052664 478
55 3300028380 Ga0268265_10000966 Ga0268265_100009664 478
56 iso_pu_bacteria 2928972540 2928974738 479
57 iso_pu_bacteria 2977240413 2977242222 479
58 3300009551 Ga0105238_10074685 Ga0105238_100746851 481
59 3300025924 Ga0207694_10058550 Ga0207694_100585503 481
60 3300025949 Ga0207667_10057901 Ga0207667_100579013 481
61 3300037312 Ga0395899_0000178 Ga0395899_0000178_57616_59088 481
62 3300037418 Ga0395900_0000006 Ga0395900_0000006_25374_26846 481
63 3300037466 Ga0395898_0001323 Ga0395898_0001323_33904_35376 481
64 3300038443 Ga0395901_0000001 Ga0395901_0000001_68622_70094 481
65 3300031824 Ga0307413_10057859 Ga0307413_100578591 482
66 3300005618 Ga0068864_100002565 Ga0068864_1000025655 483
67 3300005841 Ga0068863_100000470 Ga0068863_10000047012 483
68 3300005842 Ga0068858_100000240 Ga0068858_10000024046 483
69 3300009177 Ga0105248_10099088 Ga0105248_100990882 483
70 3300013105 Ga0157369_10072468 Ga0157369_100724682 483
71 3300025941 Ga0207711_10009151 Ga0207711_100091515 483
72 3300026035 Ga0207703_10000079 Ga0207703_1000007912 483
73 3300026088 Ga0207641_10000034 Ga0207641_1000003412 483
74 3300026095 Ga0207676_10000103 Ga0207676_1000010363 483
75 3300046558 Ga0495633_0007054 Ga0495633_0007054_3284_4768 483
76 3300046684 Ga0495669_0000054 Ga0495669_0000054_48306_49811 483
77 3300053142 Ga0500577_0001578 Ga0500577_0001578_969_2489 483
78 3300005614 Ga0068856_100156539 Ga0068856_1001565393 484
79 3300009093 Ga0105240_10010514 Ga0105240_100105146 484
80 3300009093 Ga0105240_10018673 Ga0105240_100186738 484
81 3300025913 Ga0207695_10006232 Ga0207695_100062329 484
82 3300026078 Ga0207702_10185446 Ga0207702_101854462 484
83 3300048918 Ga0496115_0000536 Ga0496115_0000536_25071_26552 484
84 3300028800 Ga0265338_10021783 Ga0265338_100217832 486
85 3300031456 Ga0307513_10000162 Ga0307513_10000162100 486
86 iso_pu_bacteria 2643221545 2643749457 487
87 iso_pu_bacteria 2643221691 2644508430 487
88 3300048927 Ga0496124_0010531 Ga0496124_0010531_5724_7238 489
89 3300053088 Ga0500644_0000012 Ga0500644_0000012_103031_104602 489
90 3300005366 Ga0070659_100000272 Ga0070659_10000027215 490
91 3300025932 Ga0207690_10000111 Ga0207690_1000011127 490
92 3300031456 Ga0307513_10019491 Ga0307513_100194917 490
93 3300031711 Ga0265314_10031999 Ga0265314_100319992 490
94 3300046694 Ga0495649_0003634 Ga0495649_0003634_1000_2604 490
95 3300031730 Ga0307516_10000154 Ga0307516_1000015456 491
96 3300053087 Ga0500643_000390 Ga0500643_000390_3043_4560 491
97 3300005843 Ga0068860_100000396 Ga0068860_10000039648 493
98 3300028381 Ga0268264_10000169 Ga0268264_1000016994 493
99 3300046507 Ga0495606_0058872 Ga0495606_0058872_338_1855 493
100 3300046542 Ga0495597_0048262 Ga0495597_0048262_272_1789 493
101 3300046660 Ga0495625_0073650 Ga0495625_0073650_834_2351 493
102 3300046660 Ga0495625_0097793 Ga0495625_0097793_89_1606 493
103 iso_pu_bacteria 2585428106 2587919475 493
104 iso_pu_bacteria 2643221640 2644225305 493
105 iso_pu_bacteria 2643221642 2644232613 493
106 iso_pu_bacteria 2857504554 2857504563 493
107 iso_pu_bacteria 2884960567 2884960666 493
108 3300047472 Ga0495686_0044368 Ga0495686_0044368_1223_2755 494
109 3300047446 Ga0495679_006763 Ga0495679_006763_2335_3852 495
110 3300047469 Ga0495673_0000225 Ga0495673_0000225_20890_22410 495
111 iso_pu_bacteria 2643221598 2644000423 495
112 3300003781 Ga0055536_1001534 Ga0055536_10015341 496
113 3300025292 Ga0209676_1000691 Ga0209676_100069141 496
114 3300025298 Ga0209050_1002310 Ga0209050_10023102 496
115 3300025303 Ga0209051_1003674 Ga0209051_10036747 496
116 3300025304 Ga0209257_1006384 Ga0209257_10063847 496
117 3300046616 Ga0495668_0000703 Ga0495668_0000703_2090_3625 496
118 3300048929 Ga0496126_0005735 Ga0496126_0005735_5212_6723 496
119 3300006186 Ga0075369_10002462 Ga0075369_100024624 497
120 3300050516 nmdc:mga0sz30_4308_c1 nmdc:mga0sz30_4308_c1_3336_4850 497
121 iso_pu_bacteria 2643221614 2644084808 497
122 iso_pu_bacteria 2643221661 2644342360 497
123 iso_pu_bacteria 2643221666 2644365660 497
124 3300009093 Ga0105240_10002488 Ga0105240_1000248816 498
125 3300025913 Ga0207695_10008945 Ga0207695_100089458 498
126 3300039437 Ga0436365_1777519 Ga0436365_1777519_2131_3663 498
127 3300047469 Ga0495673_0000605 Ga0495673_0000605_18476_20047 499
128 iso_pu_bacteria 2739367756 2739793390 499
129 iso_pu_bacteria 2818991435 2819536956 499
130 iso_pu_bacteria 2818991454 2819645368 499
131 iso_pu_bacteria 2643221552 2643782263 500
132 iso_pu_bacteria 2643221584 2643928948 500
133 3300028380 Ga0268265_10021085 Ga0268265_100210855 501
134 iso_pu_bacteria 2582581279 2585146854 501
135 iso_pu_bacteria 2582581280 2585151452 501
136 iso_pu_bacteria 2582581293 2585196166 501
137 iso_pu_bacteria 2643221583 2643926514 501
138 3300046460 Ga0495638_0002007 Ga0495638_0002007_121_1629 502
139 3300046513 Ga0495616_0000206 Ga0495616_0000206_32416_33924 502
140 3300046519 Ga0495632_0000727 Ga0495632_0000727_21880_23388 502
141 iso_pu_bacteria 2510917020 2511124269 502
142 3300003794 Ga0055531_10009626 Ga0055531_100096264 503
143 3300025297 Ga0209758_1000919 Ga0209758_100091915 503
144 3300025304 Ga0209257_1000187 Ga0209257_100018711 503
145 3300046506 Ga0495583_0000002 Ga0495583_0000002_6782_8293 503
146 3300046519 Ga0495632_0029052 Ga0495632_0029052_902_2416 504
147 3300046524 Ga0495648_0001795 Ga0495648_0001795_15879_17450 504
148 3300046616 Ga0495668_0011886 Ga0495668_0011886_933_2447 504
149 3300046616 Ga0495668_0070853 Ga0495668_0070853_152_1666 504
150 3300053102 Ga0500554_000939 Ga0500554_000939_3615_5129 504
151 3300053138 Ga0500564_000150 Ga0500564_000150_4849_6420 504
152 3300005262 Ga0065165_1001578 Ga0065165_10015785 505
153 3300025295 Ga0209564_1001401 Ga0209564_10014012 505
154 3300028794 Ga0307515_10093590 Ga0307515_100935905 505
155 3300031251 Ga0265327_10000525 Ga0265327_100005252 505
156 3300046457 Ga0495590_0012149 Ga0495590_0012149_1206_2765 505
157 3300046460 Ga0495638_0001868 Ga0495638_0001868_12478_14037 505
158 3300046512 Ga0495610_0002170 Ga0495610_0002170_11764_13323 505
159 3300046513 Ga0495616_0030336 Ga0495616_0030336_416_1975 505
160 3300046518 Ga0495631_0006715 Ga0495631_0006715_2854_4413 505
161 3300047469 Ga0495673_0003491 Ga0495673_0003491_2621_4138 505
162 3300047472 Ga0495686_0000449 Ga0495686_0000449_22544_24103 505
163 3300049459 Ga0495678_000483 Ga0495678_000483_21444_23003 505
164 3300053086 Ga0500578_0000043 Ga0500578_0000043_13404_14963 505
165 3300053118 Ga0500594_0000030 Ga0500594_0000030_32644_34203 505
166 3300053125 Ga0500618_000064 Ga0500618_000064_45289_46806 505
167 3300053136 Ga0500559_0000056 Ga0500559_0000056_14214_15731 505
168 3300053156 Ga0500622_0000248 Ga0500622_0000248_13270_14829 505
169 3300003773 Ga0055537_1001703 Ga0055537_10017035 506
170 3300003775 Ga0055524_1017856 Ga0055524_10178563 506
171 3300025263 Ga0209565_1000195 Ga0209565_100019532 506
172 3300025273 Ga0209673_1005936 Ga0209673_10059365 506
173 3300025297 Ga0209758_1002640 Ga0209758_10026404 506
174 3300025299 Ga0209256_1007158 Ga0209256_10071583 506
175 3300025299 Ga0209256_1013181 Ga0209256_10131813 506
176 3300028794 Ga0307515_10139025 Ga0307515_101390252 506
177 3300046460 Ga0495638_0000360 Ga0495638_0000360_47209_48729 506
178 3300046460 Ga0495638_0034084 Ga0495638_0034084_946_2472 506
179 3300046471 Ga0495650_0000030 Ga0495650_0000030_365374_366894 506
180 3300046507 Ga0495606_0026340 Ga0495606_0026340_819_2339 506
181 3300046512 Ga0495610_0000091 Ga0495610_0000091_74332_75852 506
182 3300046519 Ga0495632_0067194 Ga0495632_0067194_67_1587 506
183 3300046530 Ga0495654_0000120 Ga0495654_0000120_16388_17908 506
184 3300046660 Ga0495625_0000058 Ga0495625_0000058_63697_65217 506
185 3300046660 Ga0495625_0000519 Ga0495625_0000519_49379_50899 506
186 3300046660 Ga0495625_0004483 Ga0495625_0004483_5802_7322 506
187 3300046660 Ga0495625_0008285 Ga0495625_0008285_7181_8701 506
188 3300046660 Ga0495625_0008713 Ga0495625_0008713_4725_6245 506
189 3300046794 Ga0495589_0005320 Ga0495589_0005320_4692_6212 506
190 3300047320 Ga0495672_0004323 Ga0495672_0004323_4845_6365 506
191 3300047472 Ga0495686_0007226 Ga0495686_0007226_270_1790 506
192 3300048904 Ga0496101_0040106 Ga0496101_0040106_904_2424 506
193 3300048910 Ga0496107_0000058 Ga0496107_0000058_47059_48579 506
194 3300048924 Ga0496121_0026594 Ga0496121_0026594_247_1767 506
195 3300053104 Ga0500556_0000913 Ga0500556_0000913_2883_4403 506
196 3300053134 Ga0500658_0019550 Ga0500658_0019550_984_2504 506

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13727

CoA_binding_3

CoA-binding domain

129

303

0.93

PF02397

Bac_transf

Bacterial sugar transferase

340

529

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nkl-assembly1.cif.gz_A crystal structure of udp-d-quinovosamine 4-dehydrogenase from vibrio fischeri 0.8653 184 282
7txp-assembly1.cif.gz_A x-ray structure of the viob n-acetyltransferase from acinetobacter baumannii in complex with tdp-4-amino-4,6-dideoxy-d-glucose 0.8259 184 267
3bio-assembly1.cif.gz_A crystal structure of oxidoreductase (gfo/idh/moca family member) from porphyromonas gingivalis w83 0.7819 184 279
5gz1-assembly1.cif.gz_B structure of substrate/cofactor-free d-amino acid dehydrogenase 0.7767 184 287
5gz3-assembly1.cif.gz_B structure of d-amino acid dehydrogenase in complex with nadp 0.7761 184 287
ID Description Score Start End Superfamily
af_Q2G1K5_138_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8556 184 282 3.40.50.720
3evnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7949 184 278 3.40.50.720
3bioA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7819 184 279 3.40.50.720
af_P71784_1_83_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7778 183 264 3.40.50.20
af_P71784_1_83_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.762 183 264 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A3E3K4M9-F1-model_v4 Sugar transferase 0.9128 303 417 GO:0016020
GO:0016780
AF-A0A538K0W1-F1-model_v4 Sugar transferase 0.8873 307 419 GO:0016020
GO:0016780
AF-A0A3D1F4L7-F1-model_v4 Bacterial sugar transferase domain-containing protein 0.8821 308 419 GO:0016020
GO:0016780
AF-A0A564U9C2-F1-model_v4 UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase (EC 2.7.8.31) 0.8639 310 423 GO:0016020
GO:0089702
AF-A0A2J0LF86-F1-model_v4 Sugar transferase 0.8484 305 419 GO:0016020
GO:0016780

Feature Viewer

pLDDT pTM Quality
70.41 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map