F301740

General Info

Members Datasets Scaffolds Average Seq Length
196 137 183 376

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10000104|Ga0307511_1000010421
Length 414
Sequence MRNADVYIASDNIVSPLGLTTAANFSQLKKGISGIRLHDDDAMSAQPFYAALFGDKDGLVGLPAPDAGAMQRSPEMYTKFERLLITSIENALQDGGIDVGDKKTVLIISSTKGNISLLETAANVSGPGRLSGLQHPTSAPGLQPSSRLDPALTERIALHTSARLITEYFGFTNPPIVASNACISGIMAILTGSRLLRSGQYENAVIAGADVISNFVLSGFQSFQAISSRPCRPFDRSRDGITLGEGAGTIILSSHRKYAGGIKVMGGSTSNDANHLSAPSRTGAELGHSINRALKEAGLSSVDIDFISAHGTATLYNDEMEAKAITLANLQAAPVNSLKGYYGHTLGAAGLIESIIAATSLKEDLVLPTIGFEEMGVSQPLNICSTLLSAPLQHCLKTASGFGGCNAALVLSKE

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
4 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
5 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
6 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
7 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
8 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
9 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
10 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
11 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
12 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
13 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
14 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
114 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
126 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
127 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
135 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.37
Metatranscriptomes 0
Isolates 6.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.1
Nodule 0
Rhizoplane 0.51
Rhizosphere 76.53
Stem 0
Stem Tuber 0
Unclassified 17.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002032 3300001915 Bacteria 5436
2 JGI24737J22298_10020193 3300001990 Bacteria 2128
3 rootH1_10013086 3300003316 Bacteria 20842
4 rootH1_10055394 3300003316 Bacteria 5079
5 rootH2_10005827 3300003320 Bacteria 117906
6 rootH2_10029611 3300003320 Bacteria 10000
7 rootL2_10013200 3300003322 Bacteria 18078
8 rootH1_10001078 3300003323 Unclassified 2316
9 rootH1_10001079 3300003323 Unclassified 3800
10 rootH1_10008235 3300003323 Bacteria 40448
11 rootH1_10174648 3300003323 Bacteria 1595
12 rootH1_10230437 3300003323 Unclassified 2306
13 rootH1_10326558 3300003323 Bacteria 3099
14 rootH1_10352568 3300003323 Bacteria 1507
15 Ga0065715_10223826 3300005293 Bacteria 1254
16 Ga0070658_10000075 3300005327 Bacteria 95412
17 Ga0070658_10083927 3300005327 Bacteria 2619
18 Ga0070676_10000314 3300005328 Bacteria 21903
19 Ga0070670_100077736 3300005331 Bacteria 2851
20 Ga0068869_100076946 3300005334 Bacteria 2481
21 Ga0070660_100032555 3300005339 Bacteria 3924
22 Ga0070660_100058442 3300005339 Bacteria 2989
23 Ga0070669_100214915 3300005353 Bacteria 1518
24 Ga0070675_100138303 3300005354 Bacteria 2080
25 Ga0070671_100011828 3300005355 Bacteria 7022
26 Ga0070659_100032916 3300005366 Bacteria 4025
27 Ga0070659_100101551 3300005366 Bacteria 2315
28 Ga0070678_100000635 3300005456 Bacteria 17178
29 Ga0070662_100000768 3300005457 Bacteria 19743
30 Ga0068867_100000584 3300005459 Bacteria 24179
31 Ga0070679_100001187 3300005530 Bacteria 22874
32 Ga0070679_100152397 3300005530 Bacteria 2288
33 Ga0070679_100312385 3300005530 Unclassified 1521
34 Ga0068853_100015527 3300005539 Bacteria 6254
35 Ga0068853_100140386 3300005539 Bacteria 2168
36 Ga0070665_100000284 3300005548 Bacteria 82062
37 Ga0068855_100021813 3300005563 Bacteria 7682
38 Ga0068855_100032262 3300005563 Bacteria 6254
39 Ga0068855_100241339 3300005563 Bacteria 2019
40 Ga0068856_100003367 3300005614 Bacteria 16201
41 Ga0068856_100017015 3300005614 Bacteria 7047
42 Ga0068856_100042037 3300005614 Bacteria 4495
43 Ga0068852_100000386 3300005616 Bacteria 29492
44 Ga0068859_100117154 3300005617 Bacteria 2729
45 Ga0068866_10023849 3300005718 Bacteria 2851
46 Ga0068851_10004169 3300005834 Bacteria 6509
47 Ga0068860_100066897 3300005843 Unclassified 3414
48 Ga0075366_10002960 3300006195 Bacteria 8842
49 Ga0097621_100003703 3300006237 Bacteria 10578
50 Ga0068871_100000070 3300006358 Bacteria 57286
51 Ga0075428_100003611 3300006844 Bacteria 16960
52 Ga0075431_100424143 3300006847 Unclassified 1329
53 Ga0068865_100000448 3300006881 Bacteria 22921
54 Ga0097620_100117156 3300006931 Bacteria 2729
55 Ga0105240_10004296 3300009093 Bacteria 21764
56 Ga0105240_10009293 3300009093 Bacteria 13938
57 Ga0105240_10115269 3300009093 Bacteria 3244
58 Ga0105240_10248531 3300009093 Bacteria 2058
59 Ga0105241_10001799 3300009174 Bacteria 16279
60 Ga0105241_10008569 3300009174 Bacteria 7512
61 Ga0105241_10058626 3300009174 Bacteria 2957
62 Ga0105242_10017392 3300009176 Bacteria 5603
63 Ga0105237_10001162 3300009545 Bacteria 35201
64 Ga0105237_10002306 3300009545 Bacteria 23725
65 Ga0105237_10057727 3300009545 Unclassified 3884
66 Ga0105237_10154317 3300009545 Bacteria 2293
67 Ga0105238_10000693 3300009551 Bacteria 35265
68 Ga0105239_10005880 3300010375 Bacteria 14296
69 Ga0105239_10156058 3300010375 Bacteria 2549
70 Ga0105246_10021864 3300011119 Bacteria 4122
71 Ga0157370_10000844 3300013104 Bacteria 38898
72 Ga0157370_10041416 3300013104 Bacteria 4444
73 Ga0157370_10209256 3300013104 Bacteria 1808
74 Ga0157374_10000076 3300013296 Bacteria 97502
75 Ga0157374_10001095 3300013296 Bacteria 23328
76 Ga0157374_10022000 3300013296 Bacteria 5682
77 Ga0157374_10414723 3300013296 Bacteria 1345
78 Ga0157378_10007851 3300013297 Bacteria 9312
79 Ga0157378_10072253 3300013297 Bacteria 3100
80 Ga0163162_10000044 3300013306 Bacteria 128200
81 Ga0157372_10011798 3300013307 Bacteria 9308
82 Ga0157375_10103641 3300013308 Bacteria 2932
83 Ga0163163_10070873 3300014325 Bacteria 3472
84 Ga0157376_10081118 3300014969 Bacteria 2785
85 Ga0213872_10008372 3300021361 Bacteria 5009
86 Ga0209233_1001096 3300025261 Bacteria 11120
87 Ga0209455_1001317 3300025272 Bacteria 11494
88 Ga0209675_1000034 3300025291 Bacteria 267827
89 Ga0207656_10002467 3300025321 Bacteria 6240
90 Ga0207647_10000209 3300025904 Bacteria 47604
91 Ga0207647_10000463 3300025904 Bacteria 32923
92 Ga0207705_10000102 3300025909 Bacteria 98105
93 Ga0207705_10065905 3300025909 Bacteria 2619
94 Ga0207654_10003165 3300025911 Bacteria 8314
95 Ga0207695_10006768 3300025913 Bacteria 14780
96 Ga0207695_10008363 3300025913 Bacteria 12962
97 Ga0207671_10032014 3300025914 Bacteria 3915
98 Ga0207671_10062852 3300025914 Unclassified 2758
99 Ga0207671_10144711 3300025914 Bacteria 1833
100 Ga0207652_10026807 3300025921 Bacteria 4802
101 Ga0207650_10054594 3300025925 Bacteria 2964
102 Ga0207659_10123287 3300025926 Bacteria 1989
103 Ga0207644_10016388 3300025931 Bacteria 4985
104 Ga0207690_10003147 3300025932 Bacteria 9907
105 Ga0207706_10000257 3300025933 Bacteria 57965
106 Ga0207704_10000016 3300025938 Bacteria 158362
107 Ga0207691_10031938 3300025940 Unclassified 4914
108 Ga0207689_10081786 3300025942 Unclassified 2655
109 Ga0207667_10006040 3300025949 Bacteria 14732
110 Ga0207703_10392574 3300026035 Unclassified 1286
111 Ga0207639_10009260 3300026041 Bacteria 6791
112 Ga0207639_10009956 3300026041 Bacteria 6569
113 Ga0207639_10113033 3300026041 Bacteria 2217
114 Ga0207702_10007832 3300026078 Bacteria 9061
115 Ga0207702_10028686 3300026078 Bacteria 4627
116 Ga0207702_10071231 3300026078 Bacteria 2993
117 Ga0207702_10151040 3300026078 Bacteria 2113
118 Ga0207648_10001694 3300026089 Bacteria 24136
119 Ga0207648_10057223 3300026089 Bacteria 3401
120 Ga0207674_10038909 3300026116 Bacteria 4933
121 Ga0268266_10000291 3300028379 Bacteria 82093
122 Ga0307517_10003309 3300028786 Bacteria 25165
123 Ga0307515_10000001 3300028794 Bacteria 4259510
124 Ga0307515_10000790 3300028794 Bacteria 72891
125 Ga0307511_10000104 3300030521 Bacteria 75069
126 Ga0265327_10049934 3300031251 Unclassified 2192
127 Ga0265327_10082117 3300031251 Bacteria 1589
128 Ga0307516_10167854 3300031730 Unclassified 1938
129 Ga0307510_10003634 3300033180 Bacteria 18006
130 Ga0373941_0001414 3300035115 Bacteria 5062
131 Ga0316584_0089247 3300036712 Bacteria 2308
132 Ga0395899_0002782 3300037312 Bacteria 14097
133 Ga0395900_0000327 3300037418 Bacteria 70365
134 Ga0395900_0005440 3300037418 Bacteria 13342
135 Ga0395905_0000461 3300037471 Bacteria 56680
136 Ga0395905_0001887 3300037471 Bacteria 24161
137 Ga0395901_0000464 3300038443 Bacteria 47061
138 Ga0395901_0019758 3300038443 Bacteria 6889
139 Ga0436365_1026110 3300039437 Bacteria 29351
140 Ga0436361_0342299 3300039447 Bacteria 3188
141 Ga0495627_000030 3300046453 Bacteria 228883
142 Ga0495580_0066851 3300046472 Bacteria 2516
143 Ga0495585_0002733 3300046492 Bacteria 12319
144 Ga0495596_0003279 3300046500 Bacteria 8266
145 Ga0495596_0027963 3300046500 Unclassified 2265
146 Ga0495606_0004317 3300046507 Bacteria 14307
147 Ga0495606_0005407 3300046507 Bacteria 12239
148 Ga0495631_0002807 3300046518 Bacteria 9670
149 Ga0495632_0021498 3300046519 Bacteria 3476
150 Ga0495648_0003800 3300046524 Bacteria 13122
151 Ga0495654_0038876 3300046530 Bacteria 2377
152 Ga0495621_0048997 3300046539 Bacteria 1506
153 Ga0495668_0000017 3300046616 Bacteria 434025
154 Ga0495625_0000435 3300046660 Bacteria 62758
155 Ga0495625_0001213 3300046660 Bacteria 32692
156 Ga0495661_0019538 3300046665 Bacteria 4438
157 Ga0495672_0066797 3300047320 Bacteria 2050
158 Ga0495683_0015625 3300047323 Bacteria 3946
159 Ga0495687_000440 3300047443 Bacteria 51285
160 Ga0495686_0001789 3300047472 Bacteria 21805
161 Ga0495686_0002500 3300047472 Bacteria 17266
162 Ga0496104_0093777 3300048907 Bacteria 2872
163 Ga0496116_0000068 3300048919 Bacteria 259724
164 Ga0496117_0000062 3300048920 Bacteria 257535
165 Ga0496118_0000113 3300048921 Bacteria 150726
166 Ga0496119_0000024 3300048922 Bacteria 257750
167 Ga0496122_0000530 3300048925 Bacteria 79156
168 Ga0496122_0001937 3300048925 Bacteria 31087
169 Ga0496122_0002619 3300048925 Bacteria 25205
170 Ga0496122_0007266 3300048925 Bacteria 12387
171 Ga0496123_0000474 3300048926 Bacteria 69869
172 Ga0496123_0030379 3300048926 Bacteria 3955
173 Ga0496125_0000454 3300048928 Bacteria 73947
174 Ga0496125_0013819 3300048928 Bacteria 7907
175 Ga0496126_0000957 3300048929 Bacteria 49532
176 Ga0495682_0007410 3300049460 Bacteria 4366
177 nmdc:mga0k408_323_c1 3300050493 Bacteria 26051
178 nmdc:mga0k408_5994_c1 3300050493 Bacteria 6487
179 nmdc:mga08y16_131874_c1 3300050511 Bacteria 2598
180 Ga0500635_0002051 3300053080 Bacteria 4923
181 Ga0500644_0012400 3300053088 Bacteria 2356
182 Ga0500616_0085097 3300053153 Bacteria 1580
183 Ga0500622_0000175 3300053156 Bacteria 69363

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0066797 Ga0495672_0066797_564_1577 330
2 3300003323 rootH1_10230437 rootH1_102304372 346
3 3300025940 Ga0207691_10031938 Ga0207691_100319385 353
4 3300037471 Ga0395905_0001887 Ga0395905_0001887_8884_10002 354
5 3300038443 Ga0395901_0019758 Ga0395901_0019758_5294_6412 354
6 3300046539 Ga0495621_0048997 Ga0495621_0048997_399_1493 356
7 3300053153 Ga0500616_0085097 Ga0500616_0085097_84_1184 356
8 3300003323 rootH1_10326558 rootH1_103265582 359
9 3300006844 Ga0075428_100003611 Ga0075428_10000361114 360
10 iso_pu_bacteria 2896085136 2896087789 360
11 3300005563 Ga0068855_100241339 Ga0068855_1002413393 361
12 3300005328 Ga0070676_10000314 Ga0070676_100003144 362
13 3300005456 Ga0070678_100000635 Ga0070678_10000063519 362
14 3300005459 Ga0068867_100000584 Ga0068867_1000005845 362
15 3300005539 Ga0068853_100015527 Ga0068853_1000155274 362
16 3300005616 Ga0068852_100000386 Ga0068852_10000038610 362
17 3300005718 Ga0068866_10023849 Ga0068866_100238493 362
18 3300006237 Ga0097621_100003703 Ga0097621_1000037037 362
19 3300006358 Ga0068871_100000070 Ga0068871_10000007048 362
20 3300006881 Ga0068865_100000448 Ga0068865_10000044821 362
21 3300009174 Ga0105241_10001799 Ga0105241_100017999 362
22 3300009545 Ga0105237_10001162 Ga0105237_1000116220 362
23 3300009551 Ga0105238_10000693 Ga0105238_100006938 362
24 3300013296 Ga0157374_10001095 Ga0157374_100010953 362
25 3300014969 Ga0157376_10081118 Ga0157376_100811183 362
26 3300025911 Ga0207654_10003165 Ga0207654_100031656 362
27 3300025914 Ga0207671_10032014 Ga0207671_100320143 362
28 3300025938 Ga0207704_10000016 Ga0207704_10000016107 362
29 3300026041 Ga0207639_10009260 Ga0207639_100092603 362
30 3300005334 Ga0068869_100076946 Ga0068869_1000769462 363
31 3300026089 Ga0207648_10001694 Ga0207648_1000169419 363
32 3300048925 Ga0496122_0001937 Ga0496122_0001937_25798_26931 363
33 3300005530 Ga0070679_100152397 Ga0070679_1001523971 364
34 3300013296 Ga0157374_10022000 Ga0157374_100220006 364
35 3300025909 Ga0207705_10065905 Ga0207705_100659052 364
36 3300003323 rootH1_10174648 rootH1_101746481 365
37 3300005614 Ga0068856_100003367 Ga0068856_1000033672 365
38 3300006847 Ga0075431_100424143 Ga0075431_1004241432 365
39 3300026078 Ga0207702_10071231 Ga0207702_100712312 365
40 3300031251 Ga0265327_10082117 Ga0265327_100821172 365
41 3300053088 Ga0500644_0012400 Ga0500644_0012400_826_1968 365
42 3300003316 rootH1_10055394 rootH1_100553943 366
43 3300003320 rootH2_10029611 rootH2_100296114 366
44 3300013297 Ga0157378_10007851 Ga0157378_100078515 366
45 3300035115 Ga0373941_0001414 Ga0373941_0001414_3724_4917 366
46 3300037418 Ga0395900_0000327 Ga0395900_0000327_43736_44860 366
47 3300047472 Ga0495686_0001789 Ga0495686_0001789_7720_8868 366
48 3300053156 Ga0500622_0000175 Ga0500622_0000175_25103_26245 366
49 3300001990 JGI24737J22298_10020193 JGI24737J22298_100201933 367
50 3300003323 rootH1_10352568 rootH1_103525681 367
51 3300005331 Ga0070670_100077736 Ga0070670_1000777362 367
52 3300005339 Ga0070660_100032555 Ga0070660_1000325554 367
53 3300005354 Ga0070675_100138303 Ga0070675_1001383032 367
54 3300005366 Ga0070659_100101551 Ga0070659_1001015513 367
55 3300005457 Ga0070662_100000768 Ga0070662_1000007684 367
56 3300005539 Ga0068853_100140386 Ga0068853_1001403861 367
57 3300005548 Ga0070665_100000284 Ga0070665_10000028437 367
58 3300005563 Ga0068855_100032262 Ga0068855_1000322625 367
59 3300006195 Ga0075366_10002960 Ga0075366_100029605 367
60 3300009093 Ga0105240_10004296 Ga0105240_1000429622 367
61 3300009093 Ga0105240_10009293 Ga0105240_100092935 367
62 3300009174 Ga0105241_10008569 Ga0105241_100085696 367
63 3300010375 Ga0105239_10156058 Ga0105239_101560583 367
64 3300011119 Ga0105246_10021864 Ga0105246_100218642 367
65 3300013296 Ga0157374_10000076 Ga0157374_1000007687 367
66 3300013306 Ga0163162_10000044 Ga0163162_1000004448 367
67 3300013307 Ga0157372_10011798 Ga0157372_100117986 367
68 3300021361 Ga0213872_10008372 Ga0213872_100083723 367
69 3300025904 Ga0207647_10000209 Ga0207647_1000020923 367
70 3300025913 Ga0207695_10006768 Ga0207695_100067684 367
71 3300025913 Ga0207695_10008363 Ga0207695_100083633 367
72 3300025925 Ga0207650_10054594 Ga0207650_100545942 367
73 3300025926 Ga0207659_10123287 Ga0207659_101232872 367
74 3300025933 Ga0207706_10000257 Ga0207706_1000025742 367
75 3300025949 Ga0207667_10006040 Ga0207667_100060405 367
76 3300026041 Ga0207639_10113033 Ga0207639_101130333 367
77 3300028379 Ga0268266_10000291 Ga0268266_1000029136 367
78 3300037312 Ga0395899_0002782 Ga0395899_0002782_5031_6155 367
79 3300037418 Ga0395900_0005440 Ga0395900_0005440_7493_8617 367
80 3300037471 Ga0395905_0000461 Ga0395905_0000461_23245_24369 367
81 3300038443 Ga0395901_0000464 Ga0395901_0000464_17871_18995 367
82 3300039437 Ga0436365_1026110 Ga0436365_1026110_21646_22770 367
83 3300039447 Ga0436361_0342299 Ga0436361_0342299_1015_2139 367
84 3300050493 nmdc:mga0k408_323_c1 nmdc:mga0k408_323_c1_1294_2439 367
85 3300003316 rootH1_10013086 rootH1_100130864 368
86 3300003320 rootH2_10005827 rootH2_1000582757 368
87 3300003322 rootL2_10013200 rootL2_100132004 368
88 3300003323 rootH1_10001078 rootH1_100010783 368
89 3300003323 rootH1_10001079 rootH1_100010792 368
90 3300003323 rootH1_10008235 rootH1_1000823529 368
91 3300005327 Ga0070658_10000075 Ga0070658_1000007534 368
92 3300005339 Ga0070660_100058442 Ga0070660_1000584421 368
93 3300005366 Ga0070659_100032916 Ga0070659_1000329163 368
94 3300005563 Ga0068855_100021813 Ga0068855_1000218133 368
95 3300005614 Ga0068856_100017015 Ga0068856_1000170155 368
96 3300009545 Ga0105237_10154317 Ga0105237_101543171 368
97 3300013104 Ga0157370_10209256 Ga0157370_102092562 368
98 3300013297 Ga0157378_10072253 Ga0157378_100722533 368
99 3300025261 Ga0209233_1001096 Ga0209233_10010967 368
100 3300025904 Ga0207647_10000463 Ga0207647_1000046326 368
101 3300025909 Ga0207705_10000102 Ga0207705_1000010235 368
102 3300025932 Ga0207690_10003147 Ga0207690_1000314710 368
103 3300026078 Ga0207702_10007832 Ga0207702_100078327 368
104 3300026089 Ga0207648_10057223 Ga0207648_100572233 368
105 3300028794 Ga0307515_10000001 Ga0307515_100000012375 368
106 3300005293 Ga0065715_10223826 Ga0065715_102238261 369
107 3300009093 Ga0105240_10115269 Ga0105240_101152692 369
108 3300009093 Ga0105240_10248531 Ga0105240_102485312 369
109 3300009174 Ga0105241_10058626 Ga0105241_100586263 369
110 3300009545 Ga0105237_10002306 Ga0105237_1000230614 369
111 3300009545 Ga0105237_10057727 Ga0105237_100577274 369
112 3300010375 Ga0105239_10005880 Ga0105239_1000588010 369
113 3300013296 Ga0157374_10414723 Ga0157374_104147232 369
114 3300014325 Ga0163163_10070873 Ga0163163_100708732 369
115 3300025272 Ga0209455_1001317 Ga0209455_10013177 369
116 3300025914 Ga0207671_10062852 Ga0207671_100628522 369
117 3300025914 Ga0207671_10144711 Ga0207671_101447112 369
118 3300026078 Ga0207702_10151040 Ga0207702_101510402 369
119 3300026116 Ga0207674_10038909 Ga0207674_100389093 369
120 3300028794 Ga0307515_10000790 Ga0307515_1000079041 369
121 3300031251 Ga0265327_10049934 Ga0265327_100499342 369
122 3300046492 Ga0495585_0002733 Ga0495585_0002733_765_1895 369
123 3300046518 Ga0495631_0002807 Ga0495631_0002807_972_2105 369
124 3300046519 Ga0495632_0021498 Ga0495632_0021498_2014_3183 369
125 3300046524 Ga0495648_0003800 Ga0495648_0003800_9017_10147 369
126 3300046530 Ga0495654_0038876 Ga0495654_0038876_555_1685 369
127 3300046616 Ga0495668_0000017 Ga0495668_0000017_258340_259470 369
128 3300046660 Ga0495625_0000435 Ga0495625_0000435_27618_28748 369
129 3300049460 Ga0495682_0007410 Ga0495682_0007410_2903_4033 369
130 3300053080 Ga0500635_0002051 Ga0500635_0002051_3167_4300 369
131 3300005327 Ga0070658_10083927 Ga0070658_100839273 370
132 3300005355 Ga0070671_100011828 Ga0070671_1000118285 370
133 3300005530 Ga0070679_100001187 Ga0070679_10000118716 370
134 3300005530 Ga0070679_100312385 Ga0070679_1003123852 370
135 3300005614 Ga0068856_100042037 Ga0068856_1000420373 370
136 3300005617 Ga0068859_100117154 Ga0068859_1001171542 370
137 3300005834 Ga0068851_10004169 Ga0068851_100041697 370
138 3300006931 Ga0097620_100117156 Ga0097620_1001171562 370
139 3300013308 Ga0157375_10103641 Ga0157375_101036412 370
140 3300025321 Ga0207656_10002467 Ga0207656_100024676 370
141 3300025921 Ga0207652_10026807 Ga0207652_100268075 370
142 3300025931 Ga0207644_10016388 Ga0207644_100163883 370
143 3300026041 Ga0207639_10009956 Ga0207639_100099568 370
144 3300026078 Ga0207702_10028686 Ga0207702_100286864 370
145 3300028786 Ga0307517_10003309 Ga0307517_1000330918 370
146 3300033180 Ga0307510_10003634 Ga0307510_100036348 370
147 3300046472 Ga0495580_0066851 Ga0495580_0066851_1155_2291 370
148 3300046500 Ga0495596_0027963 Ga0495596_0027963_995_2167 370
149 3300046660 Ga0495625_0001213 Ga0495625_0001213_18558_19691 370
150 3300046665 Ga0495661_0019538 Ga0495661_0019538_2625_3779 370
151 3300047323 Ga0495683_0015625 Ga0495683_0015625_530_1702 370
152 3300047443 Ga0495687_000440 Ga0495687_000440_49486_50619 370
153 3300050493 nmdc:mga0k408_5994_c1 nmdc:mga0k408_5994_c1_1744_2877 370
154 3300050511 nmdc:mga08y16_131874_c1 nmdc:mga08y16_131874_c1_294_1430 370
155 3300005843 Ga0068860_100066897 Ga0068860_1000668975 371
156 3300009176 Ga0105242_10017392 Ga0105242_100173926 371
157 3300025942 Ga0207689_10081786 Ga0207689_100817863 371
158 3300026035 Ga0207703_10392574 Ga0207703_103925741 371
159 3300030521 Ga0307511_10000104 Ga0307511_1000010421 372
160 iso_pu_bacteria 2511231000 2511233465 372
161 iso_pu_bacteria 2582581281 2585157750 372
162 iso_pu_bacteria 2582581282 2585162117 372
163 3300036712 Ga0316584_0089247 Ga0316584_0089247_1014_2159 373
164 iso_pu_bacteria 2739367874 2740059630 373
165 3300031730 Ga0307516_10167854 Ga0307516_101678542 375
166 iso_pu_bacteria 2751185877 2753674782 375
167 3300005353 Ga0070669_100214915 Ga0070669_1002149152 377
168 3300013104 Ga0157370_10041416 Ga0157370_100414165 377
169 3300046507 Ga0495606_0004317 Ga0495606_0004317_5818_6951 377
170 3300046507 Ga0495606_0005407 Ga0495606_0005407_9212_10345 377
171 iso_pu_bacteria 2582581873 2585426385 378
172 3300013104 Ga0157370_10000844 Ga0157370_1000084414 379
173 3300048929 Ga0496126_0000957 Ga0496126_0000957_20162_21301 379
174 iso_pu_bacteria 2582581278 2585141918 381
175 iso_pu_bacteria 2585428182 2588212051 381
176 iso_pu_bacteria 2585428183 2588216288 381
177 iso_pu_bacteria 2585428184 2588221142 381
178 iso_pu_bacteria 2585428185 2588225592 381
179 iso_pu_bacteria 2816332188 2816876094 381
180 3300046453 Ga0495627_000030 Ga0495627_000030_37396_38568 384
181 3300047472 Ga0495686_0002500 Ga0495686_0002500_13094_14266 384
182 3300048907 Ga0496104_0093777 Ga0496104_0093777_742_1899 384
183 3300048919 Ga0496116_0000068 Ga0496116_0000068_222708_223865 384
184 3300048920 Ga0496117_0000062 Ga0496117_0000062_220643_221800 384
185 3300048921 Ga0496118_0000113 Ga0496118_0000113_131769_132926 384
186 3300048922 Ga0496119_0000024 Ga0496119_0000024_220654_221811 384
187 3300048925 Ga0496122_0002619 Ga0496122_0002619_6617_7774 384
188 3300048926 Ga0496123_0000474 Ga0496123_0000474_32969_34126 384
189 3300048928 Ga0496125_0013819 Ga0496125_0013819_6459_7616 384
190 3300001915 JGI24741J21665_1002032 JGI24741J21665_10020322 385
191 3300025291 Ga0209675_1000034 Ga0209675_1000034213 385
192 3300046500 Ga0495596_0003279 Ga0495596_0003279_3558_4715 385
193 3300048925 Ga0496122_0000530 Ga0496122_0000530_31492_32652 385
194 3300048925 Ga0496122_0007266 Ga0496122_0007266_9623_10789 385
195 3300048926 Ga0496123_0030379 Ga0496123_0030379_786_1952 385
196 3300048928 Ga0496125_0000454 Ga0496125_0000454_42263_43429 385

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02801

Ketoacyl-synt_C

Beta-ketoacyl synthase, C-terminal domain

262

373

0.93

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

3

257

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kxf-assembly1.cif.gz_A the ishigamide ketosynthase/chain length factor 0.8951 1 385
6kxf-assembly1.cif.gz_A the ishigamide ketosynthase/chain length factor 0.8928 1 385
4f32-assembly1.cif.gz_A crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase ii from burkholderia vietnamiensis in complex with platencin 0.8898 4 385
4jga-assembly1.cif.gz_B x-ray crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase 2 from rickettsia rickettsii 0.888 3 385
1e5m-assembly1.cif.gz_A-2 beta ketoacyl acyl carrier protein synthase ii (kasii) from synechocystis sp. 0.8866 2 384
ID Description Score Start End Superfamily
1j3nB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9476 241 379 3.40.47.10
4ewgB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9351 239 385 3.40.47.10
af_I1N0K0_264_378_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9295 235 342 3.40.47.10
af_P9WQD9_267_416_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9194 237 385 3.40.47.10
4ewgB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.917 239 385 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A0T0MAY0-F1-model_v4 Beta-ketoacyl synthase 0.99 1 385 GO:0004315
GO:0006633
AF-A0A0T0MAY0-F1-model_v4 Beta-ketoacyl synthase 0.9874 1 385 GO:0004315
GO:0006633
AF-A0A2S9CL41-F1-model_v4 Beta-ketoacyl synthase 0.9852 1 385 GO:0004315
GO:0005829
GO:0006633
AF-A0A2S9CL41-F1-model_v4 Beta-ketoacyl synthase 0.9827 1 385 GO:0004315
GO:0005829
GO:0006633
AF-A0A161SI96-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase-1 (Beta-ketoacyl synthase) 0.9755 1 385 GO:0004315
GO:0006633

Feature Viewer

pLDDT pTM Quality
91.7 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map