F301644

General Info

Members Datasets Scaffolds Average Seq Length
196 163 134 314

Family's Representative Sequence

Representative Sequence 3300025735|Ga0207713_1000836|Ga0207713_100083614
Length 365
Sequence VRAPIVKVRTIATQNRLLLHSIAENGDVHCLHQGKPNAEEQQMSRQTPLHSGFSAATTAAEVLKDRQLAGTTALVTGGHSGLGLETTRALTQAGARVIVAARDPAVARAQLSGLSNVEVYPLDLADLDSVRHLAQRLLETGVHLDILICSAGIMACPETRVGPGWEAQFATNHLGHYALVNLLWPALKGGARVVGHHASAIRWHDVQFSREYDKWLAYGQAKTANALFAVQLDTLGQAAGVRAFSLHPGMIPTPLQRYISPEEMVMLGWTDAEGNPAHPEMLKTPQQGAATQVWAATSPQLAGLGGLYCEDCDIAHRDPSDQIGFSGVKAHAIDPRQAERLWALSAQLTGIDAFQHAGTGGQPHA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
6 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
7 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
8 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
9 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
10 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
11 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
12 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
13 2643221629 Devosia sp. Root105 Isolate Unclassified
14 2643221662 Devosia sp. Root413D1 Isolate Unclassified
15 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
16 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
17 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
18 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
19 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
20 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
21 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
22 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
23 2818991452 Burkholderia cepacia 561 Isolate Unclassified
24 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
25 2831864461 Roseateles noduli HZ7 Isolate Nodule
26 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
27 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
28 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
29 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
30 2858882152 Micromonospora noduli MED15 Isolate Nodule
31 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
32 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
33 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
34 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
35 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
36 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
37 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
38 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
39 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
40 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
41 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
42 2891562705 Microbispora tritici MT50 Isolate Unclassified
43 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
44 2904564687 Burkholderia sp. 571 Isolate Unclassified
45 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
46 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
47 2928170801 Burkholderia sp. 572 Isolate Unclassified
48 2928536128 Burkholderia sola 565 Isolate Unclassified
49 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
50 2937967321 Serratia sp. YC16 Isolate Unclassified
51 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
52 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
53 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
54 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
55 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
56 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
57 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
58 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
59 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
60 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
61 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
62 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
63 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
101 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
112 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
122 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
152 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
153 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
154 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
155 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
156 8004592986 Serratia sp. S119 Isolate Unclassified
157 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
158 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
159 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
160 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
161 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
162 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
163 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 68.37
Metatranscriptomes 0
Isolates 31.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.29
Nodule 3.06
Rhizoplane 5.1
Rhizosphere 43.88
Stem 0
Stem Tuber 0
Unclassified 33.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1953019 2162886007 Bacteria 2130
2 rootH1_10154456 3300003323 Bacteria 1967
3 Ga0055532_1000137 3300003758 Bacteria 71979
4 Ga0055532_1000167 3300003758 Bacteria 55832
5 Ga0055527_1001787 3300003760 Bacteria 4107
6 Ga0055527_1004109 3300003760 Bacteria 2044
7 Ga0055535_1000126 3300003761 Bacteria 81550
8 Ga0055542_1000169 3300003762 Bacteria 81550
9 Ga0055529_1000172 3300003763 Bacteria 89025
10 Ga0055528_1006863 3300003790 Bacteria 5113
11 Ga0055540_1011561 3300003792 Bacteria 2836
12 Ga0058692_1008658 3300003856 Bacteria 2617
13 Ga0065165_1000373 3300005262 Bacteria 72986
14 Ga0065704_10082432 3300005289 Bacteria 3600
15 Ga0070668_100000663 3300005347 Bacteria 23311
16 Ga0070675_100115851 3300005354 Bacteria 2272
17 Ga0068853_100012666 3300005539 Bacteria 6867
18 Ga0081539_10000242 3300005985 Bacteria 127897
19 Ga0105251_10000710 3300009011 Bacteria 30647
20 Ga0105251_10029344 3300009011 Bacteria 2771
21 Ga0105244_10000615 3300009036 Bacteria 31587
22 Ga0105244_10026832 3300009036 Bacteria 3112
23 Ga0105250_10000034 3300009092 Bacteria 157547
24 Ga0105250_10001476 3300009092 Bacteria 12721
25 Ga0105240_10002714 3300009093 Bacteria 28107
26 Ga0105247_10000387 3300009101 Bacteria 37452
27 Ga0105035_100597 3300009988 Bacteria 2235
28 Ga0157371_10000727 3300013102 Bacteria 38538
29 Ga0163162_10029629 3300013306 Bacteria 5418
30 Ga0182007_10002628 3300015262 Bacteria 8841
31 Ga0163161_10000002 3300017792 Bacteria 411983
32 Ga0209566_100272 3300025225 Bacteria 48279
33 Ga0209672_100025 3300025228 Bacteria 350006
34 Ga0209672_106633 3300025228 Bacteria 1863
35 Ga0209147_100032 3300025229 Bacteria 350006
36 Ga0209147_100143 3300025229 Bacteria 110480
37 Ga0209437_100249 3300025233 Bacteria 85649
38 Ga0209258_100050 3300025242 Bacteria 350006
39 Ga0209148_1000060 3300025254 Bacteria 350006
40 Ga0209455_1000055 3300025272 Bacteria 350006
41 Ga0209673_1000044 3300025273 Bacteria 290647
42 Ga0209564_1006070 3300025295 Bacteria 6653
43 Ga0207426_1008056 3300025302 Bacteria 4319
44 Ga0209051_1001094 3300025303 Bacteria 25013
45 Ga0207696_1000009 3300025711 Bacteria 564405
46 Ga0207696_1000107 3300025711 Bacteria 157537
47 Ga0207655_1000054 3300025728 Bacteria 281894
48 Ga0207655_1089498 3300025728 Bacteria 1087
49 Ga0207713_1000836 3300025735 Bacteria 28375
50 Ga0207710_10000015 3300025900 Bacteria 393018
51 Ga0207695_10000372 3300025913 Bacteria 101840
52 Ga0207667_10077415 3300025949 Bacteria 3449
53 Ga0207668_10004348 3300025972 Bacteria 8321
54 Ga0207677_10023730 3300026023 Bacteria 3795
55 Ga0209371_1000067 3300027312 Bacteria 210294
56 Ga0268256_1000078 3300030500 Bacteria 176504
57 Ga0307511_10099662 3300030521 Bacteria 1916
58 Ga0307513_10000005 3300031456 Bacteria 553227
59 Ga0307514_10163579 3300031649 Bacteria 1468
60 Ga0307516_10288950 3300031730 Bacteria 1319
61 Ga0307518_10000121 3300031838 Bacteria 55066
62 Ga0307411_10012778 3300032005 Bacteria 4601
63 Ga0307415_100041688 3300032126 Bacteria 3050
64 Ga0395898_0437221 3300037466 Bacteria 1246
65 Ga0439463_001917 3300042016 Bacteria 5395
66 Ga0466972_0012076 3300044658 Bacteria 4339
67 Ga0495617_000094 3300046452 Bacteria 62660
68 Ga0495627_000042 3300046453 Bacteria 189845
69 Ga0495638_0010130 3300046460 Bacteria 6564
70 Ga0495650_0000541 3300046471 Bacteria 53972
71 Ga0495605_0002072 3300046474 Bacteria 12635
72 Ga0495605_0044290 3300046474 Bacteria 2201
73 Ga0495594_0010548 3300046499 Bacteria 4792
74 Ga0495607_0000436 3300046501 Bacteria 42138
75 Ga0495607_0012896 3300046501 Bacteria 5496
76 Ga0495616_0043402 3300046513 Bacteria 2284
77 Ga0495631_0021777 3300046518 Bacteria 2983
78 Ga0495643_0000733 3300046522 Bacteria 37388
79 Ga0495642_0000080 3300046528 Bacteria 57160
80 Ga0495654_0040944 3300046530 Bacteria 2306
81 Ga0495609_0000218 3300046538 Bacteria 57196
82 Ga0495611_0000343 3300046648 Bacteria 30338
83 Ga0495611_0124970 3300046648 Bacteria 1200
84 Ga0495658_0030963 3300046683 Bacteria 2910
85 Ga0495670_0097101 3300046691 Bacteria 1514
86 Ga0495589_0000333 3300046794 Bacteria 36998
87 Ga0495636_0000027 3300047318 Bacteria 62083
88 Ga0495672_0000326 3300047320 Bacteria 62915
89 Ga0495672_0051222 3300047320 Bacteria 2433
90 Ga0495673_0000569 3300047469 Bacteria 37420
91 Ga0496102_0010146 3300048905 Bacteria 8099
92 Ga0496103_0042880 3300048906 Bacteria 2785
93 Ga0496103_0051162 3300048906 Bacteria 2557
94 Ga0496116_0000015 3300048919 Bacteria 560702
95 Ga0496116_0008186 3300048919 Bacteria 9123
96 Ga0496116_0029509 3300048919 Bacteria 3953
97 Ga0496117_0011325 3300048920 Bacteria 7994
98 Ga0496117_0049641 3300048920 Bacteria 2982
99 Ga0496117_0053143 3300048920 Bacteria 2848
100 Ga0496118_0000126 3300048921 Bacteria 135644
101 Ga0496118_0015932 3300048921 Bacteria 6925
102 Ga0496118_0047017 3300048921 Bacteria 3350
103 Ga0496118_0069069 3300048921 Bacteria 2561
104 Ga0496119_0001146 3300048922 Bacteria 33275
105 Ga0496119_0002260 3300048922 Bacteria 21408
106 Ga0496119_0008142 3300048922 Bacteria 9278
107 Ga0496119_0055258 3300048922 Bacteria 2412
108 Ga0496120_0000510 3300048923 Bacteria 60563
109 Ga0496120_0001006 3300048923 Bacteria 37957
110 Ga0496120_0001526 3300048923 Bacteria 27270
111 Ga0496120_0073742 3300048923 Bacteria 1866
112 Ga0496121_0020025 3300048924 Bacteria 6651
113 Ga0496122_0041282 3300048925 Bacteria 3650
114 Ga0496122_0092468 3300048925 Bacteria 2056
115 Ga0496123_0035804 3300048926 Bacteria 3530
116 Ga0496124_0000008 3300048927 Bacteria 864372
117 Ga0496124_0000058 3300048927 Bacteria 242191
118 Ga0496125_0006800 3300048928 Bacteria 12280
119 Ga0496125_0015317 3300048928 Bacteria 7421
120 Ga0496125_0036976 3300048928 Bacteria 4251
121 Ga0496125_0187311 3300048928 Bacteria 1371
122 Ga0496126_0027541 3300048929 Bacteria 5426
123 Ga0495682_0003240 3300049460 Bacteria 7296
124 Ga0495682_0036694 3300049460 Bacteria 1804
125 Ga0501032_0034758 3300049569 Bacteria 3448
126 Ga0501034_0274001 3300049571 Bacteria 1628
127 Ga0501036_0112159 3300049572 Bacteria 2304
128 Ga0501047_0059622 3300049581 Bacteria 3684
129 Ga0501045_0042032 3300049824 Bacteria 3327
130 nmdc:mga0yw44_25144_c1 3300050492 Bacteria 3380
131 Ga0500557_003609 3300053105 Bacteria 3105
132 Ga0500560_005258 3300053107 Bacteria 2847
133 Ga0500622_0012257 3300053156 Bacteria 4648
134 Ga0500627_0098556 3300053158 Bacteria 1311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046452 Ga0495617_000094 Ga0495617_000094_26169_26963 262
2 3300046471 Ga0495650_0000541 Ga0495650_0000541_25580_26374 262
3 3300046474 Ga0495605_0002072 Ga0495605_0002072_11104_11898 262
4 3300046501 Ga0495607_0000436 Ga0495607_0000436_35874_36668 262
5 3300046522 Ga0495643_0000733 Ga0495643_0000733_35857_36651 262
6 3300046530 Ga0495654_0040944 Ga0495654_0040944_91_885 262
7 3300046648 Ga0495611_0000343 Ga0495611_0000343_2877_3671 262
8 3300046794 Ga0495589_0000333 Ga0495589_0000333_35467_36261 262
9 3300047318 Ga0495636_0000027 Ga0495636_0000027_35838_36632 262
10 3300047320 Ga0495672_0000326 Ga0495672_0000326_26196_26990 262
11 3300047469 Ga0495673_0000569 Ga0495673_0000569_738_1532 262
12 3300049460 Ga0495682_0003240 Ga0495682_0003240_3788_4582 262
13 iso_pu_bacteria 2808606388 2808995618 276
14 3300048925 Ga0496122_0092468 Ga0496122_0092468_41_913 280
15 3300047320 Ga0495672_0051222 Ga0495672_0051222_1244_2248 290
16 3300005354 Ga0070675_100115851 Ga0070675_1001158511 295
17 3300003856 Ga0058692_1008658 Ga0058692_10086582 296
18 3300027312 Ga0209371_1000067 Ga0209371_1000067134 296
19 3300030500 Ga0268256_1000078 Ga0268256_1000078140 296
20 3300031649 Ga0307514_10163579 Ga0307514_101635791 296
21 3300044658 Ga0466972_0012076 Ga0466972_0012076_1111_2097 296
22 3300025233 Ga0209437_100249 Ga0209437_10024971 297
23 3300032005 Ga0307411_10012778 Ga0307411_100127784 298
24 iso_pu_bacteria 2855676851 2855677581 299
25 iso_pu_bacteria 2858848962 2858852909 299
26 iso_pu_bacteria 2858888857 2858891358 299
27 iso_pu_bacteria 2858895516 2858901413 299
28 iso_pu_bacteria 2869048445 2869051869 299
29 iso_pu_bacteria 2880489317 2880490020 299
30 iso_pu_bacteria 8054727385 8054730446 299
31 iso_pu_bacteria 2855670206 2855671936 301
32 iso_pu_bacteria 2857288857 2857291567 301
33 iso_pu_bacteria 2858882152 2858885566 301
34 iso_pu_bacteria 2869061728 2869065301 301
35 iso_pu_bacteria 2869068681 2869069955 301
36 iso_pu_bacteria 2880495981 2880499682 301
37 iso_pu_bacteria 8054734606 8054738676 301
38 3300046648 Ga0495611_0124970 Ga0495611_0124970_215_1177 302
39 3300003758 Ga0055532_1000137 Ga0055532_100013730 304
40 3300003790 Ga0055528_1006863 Ga0055528_10068634 304
41 3300025229 Ga0209147_100143 Ga0209147_10014335 304
42 3300025273 Ga0209673_1000044 Ga0209673_100004476 304
43 3300025295 Ga0209564_1006070 Ga0209564_10060706 304
44 3300032126 Ga0307415_100041688 Ga0307415_1000416882 304
45 iso_pu_bacteria 2891562705 2891568279 304
46 3300025949 Ga0207667_10077415 Ga0207667_100774152 306
47 3300048919 Ga0496116_0029509 Ga0496116_0029509_2258_3223 306
48 3300048920 Ga0496117_0049641 Ga0496117_0049641_1367_2332 306
49 3300048921 Ga0496118_0047017 Ga0496118_0047017_1233_2198 306
50 3300005985 Ga0081539_10000242 Ga0081539_10000242130 307
51 3300048919 Ga0496116_0008186 Ga0496116_0008186_441_1430 310
52 iso_pu_bacteria 2990044586 2990045346 310
53 3300009011 Ga0105251_10029344 Ga0105251_100293443 311
54 3300009092 Ga0105250_10001476 Ga0105250_1000147612 311
55 3300009093 Ga0105240_10002714 Ga0105240_1000271426 311
56 3300009101 Ga0105247_10000387 Ga0105247_100003876 311
57 3300017792 Ga0163161_10000002 Ga0163161_10000002155 311
58 3300025711 Ga0207696_1000009 Ga0207696_1000009218 311
59 3300025900 Ga0207710_10000015 Ga0207710_10000015307 311
60 3300025913 Ga0207695_10000372 Ga0207695_1000037264 311
61 3300046453 Ga0495627_000042 Ga0495627_000042_45290_46276 311
62 3300048906 Ga0496103_0042880 Ga0496103_0042880_267_1253 311
63 3300048919 Ga0496116_0000015 Ga0496116_0000015_240627_241613 311
64 3300048920 Ga0496117_0053143 Ga0496117_0053143_960_1946 311
65 3300048921 Ga0496118_0069069 Ga0496118_0069069_250_1236 311
66 3300050492 nmdc:mga0yw44_25144_c1 nmdc:mga0yw44_25144_c1_283_1227 311
67 3300031456 Ga0307513_10000005 Ga0307513_10000005332 312
68 iso_pu_bacteria 2585427649 2586064846 312
69 3300025728 Ga0207655_1000054 Ga0207655_1000054202 313
70 3300031730 Ga0307516_10288950 Ga0307516_102889502 313
71 3300042016 Ga0439463_001917 Ga0439463_001917_1187_2143 313
72 iso_pu_bacteria 2643221629 2644169800 313
73 iso_pu_bacteria 2643221662 2644350435 313
74 iso_pu_bacteria 2728369276 2729908965 313
75 iso_pu_bacteria 2808606522 2809585915 313
76 3300009036 Ga0105244_10000615 Ga0105244_1000061510 314
77 3300048922 Ga0496119_0008142 Ga0496119_0008142_6274_7242 314
78 3300048923 Ga0496120_0001006 Ga0496120_0001006_10434_11402 314
79 3300048927 Ga0496124_0000058 Ga0496124_0000058_21814_22782 314
80 iso_pu_bacteria 2511231006 2511267231 314
81 iso_pu_bacteria 2597489887 2597858316 314
82 iso_pu_bacteria 2599185185 2599486297 314
83 iso_pu_bacteria 2599185239 2599737721 314
84 iso_pu_bacteria 2599185240 2599744991 314
85 iso_pu_bacteria 2599185257 2599802921 314
86 iso_pu_bacteria 2599185355 2600206828 314
87 iso_pu_bacteria 2671180172 2671769457 314
88 iso_pu_bacteria 2675903129 2676743281 314
89 iso_pu_bacteria 2818991452 2819635567 314
90 iso_pu_bacteria 2818991463 2819695539 314
91 iso_pu_bacteria 2904564687 2904566913 314
92 iso_pu_bacteria 2904571731 2904574143 314
93 iso_pu_bacteria 2928170801 2928176979 314
94 iso_pu_bacteria 2928536128 2928541254 314
95 iso_pu_bacteria 641736154 642417619 314
96 iso_pu_bacteria 8018845410 8018852953 314
97 iso_pu_bacteria 8020938398 8020941306 314
98 iso_pu_bacteria 8020953355 8020956643 314
99 iso_pu_bacteria 8021120328 8021124768 314
100 3300005539 Ga0068853_100012666 Ga0068853_1000126664 315
101 3300009011 Ga0105251_10000710 Ga0105251_1000071016 315
102 3300009988 Ga0105035_100597 Ga0105035_1005972 315
103 3300025735 Ga0207713_1000836 Ga0207713_100083614 315
104 3300026023 Ga0207677_10023730 Ga0207677_100237304 315
105 3300030521 Ga0307511_10099662 Ga0307511_100996623 315
106 iso_pu_bacteria 2772190666 2772437179 315
107 iso_pu_bacteria 2937967321 2937970774 315
108 iso_pu_bacteria 8004592986 8004597869 315
109 iso_pu_bacteria 8057568493 8057573400 315
110 3300031838 Ga0307518_10000121 Ga0307518_1000012120 316
111 3300053158 Ga0500627_0098556 Ga0500627_0098556_214_1173 316
112 iso_pu_bacteria 2501025501 2501070195 316
113 iso_pu_bacteria 2510917015 2511105191 316
114 iso_pu_bacteria 2643221571 2643874183 316
115 iso_pu_bacteria 2687453129 2687577974 316
116 iso_pu_bacteria 2881412998 2881413256 316
117 3300005347 Ga0070668_100000663 Ga0070668_10000066321 317
118 3300013102 Ga0157371_10000727 Ga0157371_1000072728 317
119 3300025972 Ga0207668_10004348 Ga0207668_100043483 317
120 3300003323 rootH1_10154456 rootH1_101544562 318
121 3300003758 Ga0055532_1000167 Ga0055532_100016749 318
122 3300003760 Ga0055527_1001787 Ga0055527_10017872 318
123 3300003760 Ga0055527_1004109 Ga0055527_10041092 318
124 3300003761 Ga0055535_1000126 Ga0055535_100012631 318
125 3300003762 Ga0055542_1000169 Ga0055542_100016931 318
126 3300003763 Ga0055529_1000172 Ga0055529_100017258 318
127 3300003792 Ga0055540_1011561 Ga0055540_10115612 318
128 3300005262 Ga0065165_1000373 Ga0065165_10003737 318
129 3300015262 Ga0182007_10002628 Ga0182007_1000262811 318
130 3300025225 Ga0209566_100272 Ga0209566_10027232 318
131 3300025228 Ga0209672_100025 Ga0209672_10002532 318
132 3300025228 Ga0209672_106633 Ga0209672_1066332 318
133 3300025229 Ga0209147_100032 Ga0209147_10003232 318
134 3300025242 Ga0209258_100050 Ga0209258_10005032 318
135 3300025254 Ga0209148_1000060 Ga0209148_100006032 318
136 3300025272 Ga0209455_1000055 Ga0209455_100005532 318
137 3300025302 Ga0207426_1008056 Ga0207426_10080562 318
138 3300025303 Ga0209051_1001094 Ga0209051_100109416 318
139 3300037466 Ga0395898_0437221 Ga0395898_0437221_160_1125 318
140 3300046691 Ga0495670_0097101 Ga0495670_0097101_274_1266 318
141 3300048922 Ga0496119_0001146 Ga0496119_0001146_13830_14795 318
142 3300048922 Ga0496119_0002260 Ga0496119_0002260_17873_18838 318
143 3300048923 Ga0496120_0000510 Ga0496120_0000510_12549_13514 318
144 3300048923 Ga0496120_0001526 Ga0496120_0001526_12554_13519 318
145 3300048927 Ga0496124_0000008 Ga0496124_0000008_291025_291990 318
146 3300049569 Ga0501032_0034758 Ga0501032_0034758_2162_3136 318
147 3300049571 Ga0501034_0274001 Ga0501034_0274001_431_1405 318
148 3300049572 Ga0501036_0112159 Ga0501036_0112159_233_1207 318
149 3300049581 Ga0501047_0059622 Ga0501047_0059622_449_1423 318
150 3300049824 Ga0501045_0042032 Ga0501045_0042032_232_1206 318
151 3300053156 Ga0500622_0012257 Ga0500622_0012257_317_1309 318
152 iso_pu_bacteria 2831864461 2831866401 318
153 iso_pu_bacteria 2862178590 2862182167 318
154 iso_pu_bacteria 2889042446 2889045463 318
155 iso_pu_bacteria 2904490793 2904492334 318
156 iso_pu_bacteria 2919160200 2919161558 318
157 iso_pu_bacteria 2931384279 2931388894 318
158 iso_pu_bacteria 2945991243 2945992537 318
159 iso_pu_bacteria 2946053406 2946055282 318
160 3300009036 Ga0105244_10026832 Ga0105244_100268321 319
161 3300025728 Ga0207655_1089498 Ga0207655_10894981 319
162 3300046499 Ga0495594_0010548 Ga0495594_0010548_3227_4192 319
163 3300046683 Ga0495658_0030963 Ga0495658_0030963_1593_2558 319
164 3300048928 Ga0496125_0006800 Ga0496125_0006800_7296_8264 319
165 3300048928 Ga0496125_0015317 Ga0496125_0015317_3379_4368 319
166 3300048928 Ga0496125_0187311 Ga0496125_0187311_42_1049 319
167 3300053107 Ga0500560_005258 Ga0500560_005258_435_1400 319
168 iso_pu_bacteria 2816332139 2816511373 319
169 iso_pu_bacteria 2864733723 2864734779 319
170 iso_pu_bacteria 2939679117 2939681844 319
171 2162886007 SwRhRL2b_contig_1953019 SwRhRL2b_1000.00005580 320
172 3300005289 Ga0065704_10082432 Ga0065704_100824324 320
173 3300009092 Ga0105250_10000034 Ga0105250_1000003486 320
174 3300013306 Ga0163162_10029629 Ga0163162_100296295 320
175 3300025711 Ga0207696_1000107 Ga0207696_100010771 320
176 3300046460 Ga0495638_0010130 Ga0495638_0010130_4099_5064 320
177 3300046474 Ga0495605_0044290 Ga0495605_0044290_69_1031 320
178 3300046501 Ga0495607_0012896 Ga0495607_0012896_1086_2048 320
179 3300046513 Ga0495616_0043402 Ga0495616_0043402_1218_2180 320
180 3300046518 Ga0495631_0021777 Ga0495631_0021777_1098_2060 320
181 3300046528 Ga0495642_0000080 Ga0495642_0000080_3027_3989 320
182 3300046538 Ga0495609_0000218 Ga0495609_0000218_53172_54134 320
183 3300048905 Ga0496102_0010146 Ga0496102_0010146_939_1910 320
184 3300048906 Ga0496103_0051162 Ga0496103_0051162_1344_2315 320
185 3300048920 Ga0496117_0011325 Ga0496117_0011325_4106_5068 320
186 3300048921 Ga0496118_0000126 Ga0496118_0000126_125638_126609 320
187 3300048921 Ga0496118_0015932 Ga0496118_0015932_2420_3382 320
188 3300048922 Ga0496119_0055258 Ga0496119_0055258_1117_2079 320
189 3300048923 Ga0496120_0073742 Ga0496120_0073742_65_1027 320
190 3300048924 Ga0496121_0020025 Ga0496121_0020025_2348_3334 320
191 3300048925 Ga0496122_0041282 Ga0496122_0041282_289_1251 320
192 3300048926 Ga0496123_0035804 Ga0496123_0035804_1978_2940 320
193 3300048928 Ga0496125_0036976 Ga0496125_0036976_973_1959 320
194 3300048929 Ga0496126_0027541 Ga0496126_0027541_1164_2126 320
195 3300049460 Ga0495682_0036694 Ga0495682_0036694_536_1498 320
196 3300053105 Ga0500557_003609 Ga0500557_003609_931_1893 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

71

264

0.92

PF08659

KR

KR domain

71

157

0.85

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

77

290

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.8687 15 315
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.8532 15 315
4pcv-assembly1.cif.gz_B the structure of bdca (yjgi) from e. coli 0.8484 25 273
4pcv-assembly1.cif.gz_A the structure of bdca (yjgi) from e. coli 0.8353 27 273
4cqm-assembly4.cif.gz_H crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.8339 27 274
ID Description Score Start End Superfamily
af_A0A0P0WC51_15_133_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9301 28 106 3.40.50.720
af_A8WG01_1_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9088 59 315 3.40.50.720
af_Q9VE80_46_330_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.908 25 315 3.40.50.720
af_Q9VE80_46_330_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8988 25 315 3.40.50.720
af_A0A0R0HY16_23_359_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8965 24 312 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Y8STD2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9942 1 316
AF-A0A839V4T4-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9921 105 316
AF-A0A2W2HCI3-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9907 1 319 GO:0005524
GO:0005886
GO:0016491
GO:0140359
AF-A0A6A5L958-F1-model_v4 deleted 0.9891 1 315
AF-A0A7W2D2T7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9856 1 319

Feature Viewer

pLDDT pTM Quality
95.37 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map