F301496

General Info

Members Datasets Scaffolds Average Seq Length
196 115 196 408

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10016968|Ga0105243_100169684
Length 439
Sequence LDHDRRRSGLRGKETTVERQDPRRDVPEKKLTRSPSLTRRRFLKGAAAVGAGALAAPLASKPWAFARSRPAPATPLEHIIIDCQENRSFDHYFGYAPFAGRFGPPRRYSQPDGNGGSVRPYEFTELSTPDIGHSWDVVHSEIDGGAMDGFYTTDGIDAMGYYTAKELPYYYSLFNTSTLCGNYFCSLAGPTWPNRFYLAAGTSGGITTNGVWGYGVFDYPIILDLLEAAGVSWKVYNIGWDSVPYGNTDNVFVFWKRWAKDQRTRGSKGGFLNDLDRGRLPQVSFIVPSYARGWDEHPPADVSVGMGIQQELITALQGSSAWDSSAYVLTYDEHGGYFDHVRPPVLDAYGSGVRVPTWVISPYAKRRHVEASQYDHVSTLKLIERVFALPTLASVNHRFDRSTPGGSNNEAANGAATGPPAPPRDRLDSIGDLTECFTF

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
80 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.16
Rhizosphere 91.33
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007232 3300003203 Bacteria 5080
2 JGI25405J52794_10005099 3300003911 Bacteria 2360
3 Ga0070683_100041192 3300005329 Bacteria 4247
4 Ga0070683_100064523 3300005329 Bacteria 3409
5 Ga0070683_100103281 3300005329 Bacteria 2686
6 Ga0070670_100007774 3300005331 Bacteria 9124
7 Ga0068869_100104130 3300005334 Bacteria 2151
8 Ga0070680_100000008 3300005336 Bacteria 100309
9 Ga0070705_100015944 3300005440 Bacteria 3894
10 Ga0070694_100007116 3300005444 Bacteria 6812
11 Ga0070708_100001610 3300005445 Bacteria 17318
12 Ga0070708_100011027 3300005445 Bacteria 7341
13 Ga0070708_100027778 3300005445 Bacteria 4859
14 Ga0070708_100062667 3300005445 Bacteria 3326
15 Ga0070708_100091940 3300005445 Bacteria 2763
16 Ga0070708_100144953 3300005445 Bacteria 2205
17 Ga0070708_100155955 3300005445 Bacteria 2126
18 Ga0070708_100200280 3300005445 Bacteria 1869
19 Ga0070662_100192965 3300005457 Bacteria 1612
20 Ga0070706_100010236 3300005467 Bacteria 8716
21 Ga0070706_100026475 3300005467 Bacteria 5335
22 Ga0070706_100029852 3300005467 Bacteria 5022
23 Ga0070706_100053481 3300005467 Bacteria 3727
24 Ga0070706_100127341 3300005467 Bacteria 2375
25 Ga0070707_100000012 3300005468 Bacteria 157939
26 Ga0070707_100023937 3300005468 Bacteria 5777
27 Ga0070707_100040900 3300005468 Bacteria 4435
28 Ga0070707_100045841 3300005468 Bacteria 4184
29 Ga0070707_100054742 3300005468 Bacteria 3826
30 Ga0070707_100272511 3300005468 Bacteria 1645
31 Ga0070707_100313961 3300005468 Bacteria 1523
32 Ga0070698_100001647 3300005471 Bacteria 24897
33 Ga0070698_100002883 3300005471 Bacteria 18923
34 Ga0070698_100010096 3300005471 Bacteria 10085
35 Ga0070698_100027135 3300005471 Bacteria 5956
36 Ga0070699_100123615 3300005518 Bacteria 2277
37 Ga0070699_100166159 3300005518 Bacteria 1954
38 Ga0070699_100271485 3300005518 Bacteria 1518
39 Ga0070697_100002597 3300005536 Bacteria 13895
40 Ga0070697_100022452 3300005536 Bacteria 5008
41 Ga0070697_100043520 3300005536 Bacteria 3636
42 Ga0070697_100184743 3300005536 Bacteria 1768
43 Ga0068853_100201941 3300005539 Bacteria 1809
44 Ga0070695_100022799 3300005545 Bacteria 3842
45 Ga0070696_100008541 3300005546 Bacteria 6855
46 Ga0070693_100041767 3300005547 Bacteria 2582
47 Ga0070704_100037774 3300005549 Bacteria 3302
48 Ga0068864_100001062 3300005618 Bacteria 23035
49 Ga0068864_100105586 3300005618 Unclassified 2504
50 Ga0068864_100112523 3300005618 Bacteria 2426
51 Ga0068863_100001777 3300005841 Bacteria 21386
52 Ga0068863_100019792 3300005841 Bacteria 6437
53 Ga0081455_10000180 3300005937 Bacteria 79630
54 Ga0081455_10001387 3300005937 Bacteria 29909
55 Ga0081455_10010788 3300005937 Bacteria 9233
56 Ga0081455_10022716 3300005937 Bacteria 5854
57 Ga0081455_10027289 3300005937 Bacteria 5233
58 Ga0081455_10027894 3300005937 Bacteria 5167
59 Ga0081455_10242048 3300005937 Bacteria 1325
60 Ga0081539_10004343 3300005985 Bacteria 15803
61 Ga0081539_10010042 3300005985 Bacteria 7788
62 Ga0070717_10026648 3300006028 Bacteria 4613
63 Ga0075432_10029155 3300006058 Bacteria 1905
64 Ga0097621_100009224 3300006237 Bacteria 7156
65 Ga0068871_100024953 3300006358 Bacteria 4644
66 Ga0075428_100003528 3300006844 Bacteria 17132
67 Ga0075428_100015878 3300006844 Bacteria 8332
68 Ga0075430_100000923 3300006846 Bacteria 23089
69 Ga0075430_100195052 3300006846 Bacteria 1682
70 Ga0075431_100007398 3300006847 Bacteria 10932
71 Ga0075433_10050086 3300006852 Bacteria 3636
72 Ga0075434_100003870 3300006871 Bacteria 13392
73 Ga0075434_100013173 3300006871 Bacteria 7856
74 Ga0075434_100083016 3300006871 Bacteria 3201
75 Ga0075434_100182528 3300006871 Unclassified 2119
76 Ga0075429_100000574 3300006880 Bacteria 28250
77 Ga0075436_100049362 3300006914 Bacteria 2904
78 Ga0075436_100193646 3300006914 Bacteria 1439
79 Ga0075435_100006435 3300007076 Bacteria 8305
80 Ga0075435_100111006 3300007076 Bacteria 2281
81 Ga0111539_10027003 3300009094 Bacteria 7012
82 Ga0105245_10002661 3300009098 Bacteria 16077
83 Ga0105245_10033689 3300009098 Bacteria 4540
84 Ga0105245_10082056 3300009098 Bacteria 2949
85 Ga0105245_10140763 3300009098 Bacteria 2272
86 Ga0114129_10004647 3300009147 Bacteria 19382
87 Ga0105243_10016968 3300009148 Bacteria 5506
88 Ga0105248_10343068 3300009177 Bacteria 1681
89 Ga0105239_10288169 3300010375 Bacteria 1849
90 Ga0163162_10121822 3300013306 Bacteria 2713
91 Ga0163163_10017871 3300014325 Bacteria 6621
92 Ga0163163_10119547 3300014325 Bacteria 2668
93 Ga0157380_10185356 3300014326 Bacteria 1832
94 Ga0157376_10015225 3300014969 Bacteria 5803
95 Ga0207684_10000878 3300025910 Bacteria 34307
96 Ga0207684_10003277 3300025910 Bacteria 15877
97 Ga0207693_10120122 3300025915 Bacteria 2064
98 Ga0207663_10166671 3300025916 Bacteria 1561
99 Ga0207663_10205588 3300025916 Bacteria 1423
100 Ga0207660_10000001 3300025917 Bacteria 1034169
101 Ga0207662_10026876 3300025918 Bacteria 3322
102 Ga0207646_10000058 3300025922 Bacteria 158096
103 Ga0207646_10005390 3300025922 Bacteria 13459
104 Ga0207646_10097490 3300025922 Bacteria 2634
105 Ga0207646_10141895 3300025922 Bacteria 2164
106 Ga0207650_10004922 3300025925 Bacteria 9122
107 Ga0207687_10079588 3300025927 Bacteria 2363
108 Ga0207700_10331876 3300025928 Bacteria 1320
109 Ga0207664_10033464 3300025929 Bacteria 3949
110 Ga0207709_10080462 3300025935 Bacteria 2098
111 Ga0207709_10106143 3300025935 Bacteria 1868
112 Ga0207689_10131326 3300025942 Bacteria 2061
113 Ga0207661_10017946 3300025944 Bacteria 5249
114 Ga0207661_10303774 3300025944 Bacteria 1431
115 Ga0207708_10010704 3300026075 Bacteria 6816
116 Ga0207708_10148516 3300026075 Bacteria 1843
117 Ga0207641_10024812 3300026088 Bacteria 4942
118 Ga0207676_10005645 3300026095 Bacteria 8856
119 Ga0207676_10207415 3300026095 Bacteria 1736
120 Ga0207675_100023989 3300026118 Bacteria 5670
121 Ga0207428_10000953 3300027907 Bacteria 32149
122 Ga0207428_10098255 3300027907 Bacteria 2266
123 Ga0268264_10096625 3300028381 Bacteria 2559
124 Ga0373937_0172929 3300036401 Unclassified 2027
125 Ga0373925_0044490 3300037068 Bacteria 3297
126 Ga0373925_0072389 3300037068 Bacteria 2608
127 Ga0395900_0026399 3300037418 Bacteria 5947
128 Ga0395900_0159084 3300037418 Bacteria 2305
129 Ga0395905_0009507 3300037471 Bacteria 9500
130 Ga0395905_0136978 3300037471 Bacteria 2304
131 Ga0436364_0264591 3300037853 Bacteria 6537
132 Ga0395901_0004441 3300038443 Bacteria 14147
133 Ga0395901_0110151 3300038443 Bacteria 2891
134 Ga0395901_0115227 3300038443 Bacteria 2823
135 Ga0242420_012580 3300038996 Bacteria 1435
136 Ga0436360_1323352 3300039438 Bacteria 1787
137 Ga0453683_0087190 3300044673 Bacteria 1956
138 Ga0466963_0002439 3300044694 Bacteria 10401
139 Ga0466963_0038850 3300044694 Bacteria 3114
140 Ga0466963_0151766 3300044694 Bacteria 1609
141 Ga0466957_0017303 3300044842 Bacteria 4220
142 Ga0466957_0135514 3300044842 Unclassified 1582
143 Ga0466967_0008724 3300045976 Bacteria 7464
144 Ga0466967_0066254 3300045976 Bacteria 3217
145 Ga0466967_0182789 3300045976 Bacteria 1978
146 Ga0495629_0000864 3300046459 Bacteria 24403
147 Ga0495641_0049152 3300046461 Bacteria 1932
148 Ga0495580_0009802 3300046472 Bacteria 7512
149 Ga0495582_0000176 3300046473 Bacteria 34608
150 Ga0495582_0004246 3300046473 Bacteria 8058
151 Ga0495608_0048725 3300046511 Bacteria 2814
152 Ga0495628_0012925 3300046516 Bacteria 7029
153 Ga0495666_0110117 3300046526 Bacteria 1294
154 Ga0495652_0005353 3300046529 Bacteria 12093
155 Ga0495665_0017706 3300046531 Bacteria 3831
156 Ga0495645_0095404 3300046543 Bacteria 2120
157 Ga0495667_0130960 3300046559 Bacteria 1618
158 Ga0495657_0075132 3300046675 Bacteria 2197
159 Ga0495647_0047495 3300046681 Bacteria 1657
160 Ga0495658_0003400 3300046683 Bacteria 7887
161 Ga0495658_0061982 3300046683 Bacteria 2149
162 Ga0495613_0000777 3300046689 Bacteria 24876
163 Ga0495581_0010016 3300047315 Bacteria 5482
164 Ga0496100_0060800 3300048903 Bacteria 2487
165 Ga0496102_0045552 3300048905 Bacteria 3983
166 Ga0496104_0066477 3300048907 Bacteria 3423
167 Ga0496104_0105431 3300048907 Bacteria 2701
168 Ga0496106_0027772 3300048909 Bacteria 4215
169 Ga0496107_0061330 3300048910 Bacteria 2723
170 Ga0496108_0196394 3300048911 Bacteria 1750
171 Ga0496109_0031507 3300048912 Bacteria 4758
172 Ga0496109_0081709 3300048912 Bacteria 2978
173 Ga0496111_0011953 3300048914 Bacteria 5867
174 Ga0496112_0030178 3300048915 Bacteria 5246
175 Ga0496112_0055758 3300048915 Bacteria 3887
176 Ga0496113_0013178 3300048916 Bacteria 5588
177 Ga0496113_0016967 3300048916 Bacteria 5041
178 Ga0496114_0156157 3300048917 Bacteria 1981
179 Ga0496115_0013676 3300048918 Bacteria 6144
180 nmdc:mga05p37_1499_c1 3300050507 Bacteria 27105
181 nmdc:mga05p37_253_c1 3300050507 Bacteria 55097
182 nmdc:mga0qj67_7681_c1 3300050509 Bacteria 7970
183 nmdc:mga06r32_191112_c1 3300050510 Bacteria 2035
184 nmdc:mga06r32_2318_c1 3300050510 Bacteria 17034
185 nmdc:mga08y16_3289_c1 3300050511 Bacteria 16749
186 nmdc:mga0n895_292708_c1 3300050512 Bacteria 1651
187 nmdc:mga0n895_80019_c1 3300050512 Bacteria 3255
188 nmdc:mga0rr50_106906_c1 3300050513 Bacteria 2208
189 nmdc:mga0rr50_20557_c1 3300050513 Bacteria 4488
190 nmdc:mga0rr50_37979_c1 3300050513 Bacteria 3481
191 nmdc:mga08x19_138829_c1 3300050514 Bacteria 1640
192 nmdc:mga08x19_32332_c1 3300050514 Bacteria 3295
193 nmdc:mga0a205_282666_c1 3300050515 Bacteria 1535
194 nmdc:mga0a205_60048_c1 3300050515 Bacteria 3672
195 Ga0495601_0013425 3300053077 Bacteria 4927
196 Ga0466962_0010697 3300061719 Bacteria 4413

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100023937 Ga0070707_1000239372 358
2 3300046459 Ga0495629_0000864 Ga0495629_0000864_21339_22424 361
3 3300046461 Ga0495641_0049152 Ga0495641_0049152_205_1290 361
4 3300046473 Ga0495582_0000176 Ga0495582_0000176_27922_29007 361
5 3300046526 Ga0495666_0110117 Ga0495666_0110117_122_1207 361
6 3300046531 Ga0495665_0017706 Ga0495665_0017706_110_1195 361
7 3300046681 Ga0495647_0047495 Ga0495647_0047495_454_1539 361
8 3300046683 Ga0495658_0003400 Ga0495658_0003400_3746_4831 361
9 3300046689 Ga0495613_0000777 Ga0495613_0000777_5463_6548 361
10 3300047315 Ga0495581_0010016 Ga0495581_0010016_1992_3077 361
11 3300005471 Ga0070698_100010096 Ga0070698_1000100962 362
12 3300048903 Ga0496100_0060800 Ga0496100_0060800_106_1206 363
13 3300005445 Ga0070708_100144953 Ga0070708_1001449532 370
14 3300005467 Ga0070706_100053481 Ga0070706_1000534813 370
15 3300005518 Ga0070699_100123615 Ga0070699_1001236152 370
16 3300005937 Ga0081455_10010788 Ga0081455_1001078810 374
17 3300037068 Ga0373925_0044490 Ga0373925_0044490_436_1569 374
18 3300005937 Ga0081455_10027289 Ga0081455_100272893 380
19 3300048912 Ga0496109_0031507 Ga0496109_0031507_2649_3896 381
20 3300048914 Ga0496111_0011953 Ga0496111_0011953_2152_3399 381
21 3300048915 Ga0496112_0055758 Ga0496112_0055758_2283_3530 381
22 3300048916 Ga0496113_0016967 Ga0496113_0016967_1822_3069 381
23 3300005329 Ga0070683_100064523 Ga0070683_1000645231 382
24 3300005539 Ga0068853_100201941 Ga0068853_1002019411 382
25 3300005547 Ga0070693_100041767 Ga0070693_1000417672 382
26 3300006871 Ga0075434_100013173 Ga0075434_1000131732 382
27 3300009177 Ga0105248_10343068 Ga0105248_103430682 382
28 3300026075 Ga0207708_10010704 Ga0207708_100107047 382
29 3300048907 Ga0496104_0105431 Ga0496104_0105431_102_1349 382
30 3300048911 Ga0496108_0196394 Ga0496108_0196394_469_1623 382
31 3300050512 nmdc:mga0n895_80019_c1 nmdc:mga0n895_80019_c1_815_1969 382
32 3300050513 nmdc:mga0rr50_20557_c1 nmdc:mga0rr50_20557_c1_2127_3281 382
33 3300050515 nmdc:mga0a205_60048_c1 nmdc:mga0a205_60048_c1_1469_2623 382
34 3300005468 Ga0070707_100054742 Ga0070707_1000547422 384
35 3300038996 Ga0242420_012580 Ga0242420_012580_34_1296 384
36 3300009098 Ga0105245_10140763 Ga0105245_101407632 385
37 3300039438 Ga0436360_1323352 Ga0436360_1323352_127_1365 385
38 3300046559 Ga0495667_0130960 Ga0495667_0130960_81_1304 385
39 3300005937 Ga0081455_10001387 Ga0081455_1000138716 386
40 3300005445 Ga0070708_100027778 Ga0070708_1000277782 387
41 3300005467 Ga0070706_100010236 Ga0070706_1000102362 387
42 3300005468 Ga0070707_100000012 Ga0070707_100000012123 387
43 3300005468 Ga0070707_100272511 Ga0070707_1002725111 387
44 3300005471 Ga0070698_100002883 Ga0070698_1000028836 387
45 3300025910 Ga0207684_10003277 Ga0207684_100032776 387
46 3300025922 Ga0207646_10000058 Ga0207646_10000058125 387
47 3300005467 Ga0070706_100029852 Ga0070706_1000298523 388
48 3300025910 Ga0207684_10000878 Ga0207684_1000087836 388
49 3300025922 Ga0207646_10005390 Ga0207646_100053907 388
50 3300005457 Ga0070662_100192965 Ga0070662_1001929651 389
51 3300009098 Ga0105245_10033689 Ga0105245_100336894 389
52 3300025927 Ga0207687_10079588 Ga0207687_100795883 389
53 3300025928 Ga0207700_10331876 Ga0207700_103318761 389
54 3300044694 Ga0466963_0002439 Ga0466963_0002439_6184_7404 389
55 3300044842 Ga0466957_0017303 Ga0466957_0017303_2922_4142 389
56 3300045976 Ga0466967_0008724 Ga0466967_0008724_3247_4467 389
57 3300048917 Ga0496114_0156157 Ga0496114_0156157_675_1892 389
58 3300005467 Ga0070706_100127341 Ga0070706_1001273412 390
59 3300005445 Ga0070708_100001610 Ga0070708_10000161014 391
60 3300045976 Ga0466967_0182789 Ga0466967_0182789_584_1804 391
61 3300046675 Ga0495657_0075132 Ga0495657_0075132_856_2103 391
62 3300006028 Ga0070717_10026648 Ga0070717_100266484 392
63 3300025915 Ga0207693_10120122 Ga0207693_101201221 393
64 3300037068 Ga0373925_0072389 Ga0373925_0072389_519_1718 393
65 3300005468 Ga0070707_100045841 Ga0070707_1000458411 394
66 3300005536 Ga0070697_100043520 Ga0070697_1000435201 394
67 3300010375 Ga0105239_10288169 Ga0105239_102881691 396
68 3300005467 Ga0070706_100026475 Ga0070706_1000264751 398
69 3300037853 Ga0436364_0264591 Ga0436364_0264591_3624_4877 398
70 3300044694 Ga0466963_0038850 Ga0466963_0038850_413_1648 398
71 3300044694 Ga0466963_0151766 Ga0466963_0151766_289_1509 398
72 3300044842 Ga0466957_0135514 Ga0466957_0135514_270_1505 398
73 3300045976 Ga0466967_0066254 Ga0466967_0066254_1817_3037 398
74 3300046472 Ga0495580_0009802 Ga0495580_0009802_5223_6491 398
75 3300046473 Ga0495582_0004246 Ga0495582_0004246_2992_4260 398
76 3300046683 Ga0495658_0061982 Ga0495658_0061982_116_1384 398
77 3300061719 Ga0466962_0010697 Ga0466962_0010697_1159_2379 398
78 3300013306 Ga0163162_10121822 Ga0163162_101218224 399
79 3300038443 Ga0395901_0110151 Ga0395901_0110151_643_1884 400
80 3300005841 Ga0068863_100019792 Ga0068863_1000197925 401
81 3300006237 Ga0097621_100009224 Ga0097621_1000092244 401
82 3300006358 Ga0068871_100024953 Ga0068871_1000249532 401
83 3300009098 Ga0105245_10082056 Ga0105245_100820562 401
84 3300014969 Ga0157376_10015225 Ga0157376_100152253 401
85 3300025916 Ga0207663_10166671 Ga0207663_101666712 401
86 3300025922 Ga0207646_10141895 Ga0207646_101418952 401
87 3300025929 Ga0207664_10033464 Ga0207664_100334642 401
88 3300026088 Ga0207641_10024812 Ga0207641_100248122 401
89 3300026095 Ga0207676_10207415 Ga0207676_102074151 401
90 3300037418 Ga0395900_0026399 Ga0395900_0026399_1898_3163 401
91 3300037471 Ga0395905_0009507 Ga0395905_0009507_5754_7019 401
92 3300037471 Ga0395905_0136978 Ga0395905_0136978_390_1655 401
93 3300038443 Ga0395901_0115227 Ga0395901_0115227_1398_2663 401
94 3300046511 Ga0495608_0048725 Ga0495608_0048725_1006_2253 401
95 3300046516 Ga0495628_0012925 Ga0495628_0012925_3975_5222 401
96 3300046529 Ga0495652_0005353 Ga0495652_0005353_3814_5061 401
97 3300046543 Ga0495645_0095404 Ga0495645_0095404_458_1705 401
98 3300048905 Ga0496102_0045552 Ga0496102_0045552_1379_2599 401
99 3300048907 Ga0496104_0066477 Ga0496104_0066477_1998_3245 401
100 3300048909 Ga0496106_0027772 Ga0496106_0027772_1367_2587 401
101 3300048910 Ga0496107_0061330 Ga0496107_0061330_241_1461 401
102 3300048912 Ga0496109_0081709 Ga0496109_0081709_1434_2681 401
103 3300048915 Ga0496112_0030178 Ga0496112_0030178_1172_2419 401
104 3300048916 Ga0496113_0013178 Ga0496113_0013178_2033_3280 401
105 3300048918 Ga0496115_0013676 Ga0496115_0013676_1663_2883 401
106 3300053077 Ga0495601_0013425 Ga0495601_0013425_2147_3394 401
107 3300005937 Ga0081455_10242048 Ga0081455_102420481 403
108 3300005440 Ga0070705_100015944 Ga0070705_1000159444 404
109 3300005445 Ga0070708_100155955 Ga0070708_1001559552 404
110 3300005468 Ga0070707_100313961 Ga0070707_1003139611 404
111 3300005536 Ga0070697_100002597 Ga0070697_1000025972 404
112 3300005545 Ga0070695_100022799 Ga0070695_1000227993 404
113 3300025918 Ga0207662_10026876 Ga0207662_100268764 404
114 3300026075 Ga0207708_10148516 Ga0207708_101485162 404
115 3300005329 Ga0070683_100103281 Ga0070683_1001032814 405
116 3300005445 Ga0070708_100062667 Ga0070708_1000626672 405
117 3300005518 Ga0070699_100166159 Ga0070699_1001661592 405
118 3300005536 Ga0070697_100022452 Ga0070697_1000224523 405
119 3300005618 Ga0068864_100105586 Ga0068864_1001055862 405
120 3300005937 Ga0081455_10027894 Ga0081455_100278943 405
121 3300006871 Ga0075434_100182528 Ga0075434_1001825282 405
122 3300006914 Ga0075436_100193646 Ga0075436_1001936461 405
123 3300025944 Ga0207661_10017946 Ga0207661_100179465 405
124 3300050514 nmdc:mga08x19_138829_c1 nmdc:mga08x19_138829_c1_83_1315 405
125 3300003911 JGI25405J52794_10005099 JGI25405J52794_100050992 406
126 3300005329 Ga0070683_100041192 Ga0070683_1000411922 406
127 3300005445 Ga0070708_100091940 Ga0070708_1000919402 406
128 3300005471 Ga0070698_100027135 Ga0070698_1000271354 406
129 3300005536 Ga0070697_100184743 Ga0070697_1001847431 406
130 3300005546 Ga0070696_100008541 Ga0070696_1000085414 406
131 3300005937 Ga0081455_10000180 Ga0081455_1000018044 406
132 3300005937 Ga0081455_10022716 Ga0081455_100227169 406
133 3300006058 Ga0075432_10029155 Ga0075432_100291553 406
134 3300006844 Ga0075428_100015878 Ga0075428_1000158785 406
135 3300006846 Ga0075430_100000923 Ga0075430_10000092316 406
136 3300006846 Ga0075430_100195052 Ga0075430_1001950522 406
137 3300006847 Ga0075431_100007398 Ga0075431_1000073983 406
138 3300006871 Ga0075434_100003870 Ga0075434_10000387014 406
139 3300006871 Ga0075434_100083016 Ga0075434_1000830162 406
140 3300006880 Ga0075429_100000574 Ga0075429_1000005745 406
141 3300006914 Ga0075436_100049362 Ga0075436_1000493623 406
142 3300007076 Ga0075435_100006435 Ga0075435_1000064353 406
143 3300009094 Ga0111539_10027003 Ga0111539_100270036 406
144 3300009148 Ga0105243_10016968 Ga0105243_100169684 406
145 3300025935 Ga0207709_10080462 Ga0207709_100804623 406
146 3300025944 Ga0207661_10303774 Ga0207661_103037741 406
147 3300026118 Ga0207675_100023989 Ga0207675_1000239895 406
148 3300027907 Ga0207428_10000953 Ga0207428_1000095326 406
149 3300027907 Ga0207428_10098255 Ga0207428_100982552 406
150 3300037418 Ga0395900_0159084 Ga0395900_0159084_29_1312 406
151 3300038443 Ga0395901_0004441 Ga0395901_0004441_3428_4711 406
152 3300050507 nmdc:mga05p37_253_c1 nmdc:mga05p37_253_c1_26452_27729 406
153 3300050509 nmdc:mga0qj67_7681_c1 nmdc:mga0qj67_7681_c1_974_2251 406
154 3300050510 nmdc:mga06r32_2318_c1 nmdc:mga06r32_2318_c1_4882_6159 406
155 3300050511 nmdc:mga08y16_3289_c1 nmdc:mga08y16_3289_c1_7708_8985 406
156 3300050512 nmdc:mga0n895_292708_c1 nmdc:mga0n895_292708_c1_273_1559 406
157 3300050513 nmdc:mga0rr50_37979_c1 nmdc:mga0rr50_37979_c1_545_1831 406
158 3300050514 nmdc:mga08x19_32332_c1 nmdc:mga08x19_32332_c1_504_1790 406
159 3300003203 JGI25406J46586_10007232 JGI25406J46586_100072323 407
160 3300005331 Ga0070670_100007774 Ga0070670_1000077742 407
161 3300005334 Ga0068869_100104130 Ga0068869_1001041302 407
162 3300005336 Ga0070680_100000008 Ga0070680_10000000872 407
163 3300005444 Ga0070694_100007116 Ga0070694_1000071165 407
164 3300005445 Ga0070708_100011027 Ga0070708_1000110275 407
165 3300005445 Ga0070708_100200280 Ga0070708_1002002801 407
166 3300005468 Ga0070707_100040900 Ga0070707_1000409004 407
167 3300005471 Ga0070698_100001647 Ga0070698_10000164726 407
168 3300005518 Ga0070699_100271485 Ga0070699_1002714851 407
169 3300005549 Ga0070704_100037774 Ga0070704_1000377743 407
170 3300005618 Ga0068864_100001062 Ga0068864_10000106219 407
171 3300005618 Ga0068864_100112523 Ga0068864_1001125232 407
172 3300005841 Ga0068863_100001777 Ga0068863_10000177710 407
173 3300005985 Ga0081539_10004343 Ga0081539_1000434313 407
174 3300005985 Ga0081539_10010042 Ga0081539_100100422 407
175 3300006844 Ga0075428_100003528 Ga0075428_10000352812 407
176 3300006852 Ga0075433_10050086 Ga0075433_100500862 407
177 3300007076 Ga0075435_100111006 Ga0075435_1001110063 407
178 3300009098 Ga0105245_10002661 Ga0105245_100026614 407
179 3300009147 Ga0114129_10004647 Ga0114129_1000464712 407
180 3300014325 Ga0163163_10017871 Ga0163163_100178713 407
181 3300014325 Ga0163163_10119547 Ga0163163_101195472 407
182 3300014326 Ga0157380_10185356 Ga0157380_101853561 407
183 3300025916 Ga0207663_10205588 Ga0207663_102055881 407
184 3300025917 Ga0207660_10000001 Ga0207660_10000001144 407
185 3300025922 Ga0207646_10097490 Ga0207646_100974902 407
186 3300025925 Ga0207650_10004922 Ga0207650_100049222 407
187 3300025935 Ga0207709_10106143 Ga0207709_101061432 407
188 3300025942 Ga0207689_10131326 Ga0207689_101313261 407
189 3300026095 Ga0207676_10005645 Ga0207676_100056455 407
190 3300028381 Ga0268264_10096625 Ga0268264_100966253 407
191 3300036401 Ga0373937_0172929 Ga0373937_0172929_563_1810 407
192 3300044673 Ga0453683_0087190 Ga0453683_0087190_399_1649 407
193 3300050507 nmdc:mga05p37_1499_c1 nmdc:mga05p37_1499_c1_17790_19052 407
194 3300050510 nmdc:mga06r32_191112_c1 nmdc:mga06r32_191112_c1_511_1773 407
195 3300050513 nmdc:mga0rr50_106906_c1 nmdc:mga0rr50_106906_c1_25_1287 407
196 3300050515 nmdc:mga0a205_282666_c1 nmdc:mga0a205_282666_c1_49_1311 407

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04185

Phosphoesterase

Phosphoesterase family

76

390

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8haw-assembly1.cif.gz_B an auto-activation mechanism of plant non-specific phospholipase c 0.8528 42 359
8hav-assembly1.cif.gz_B an auto-activation mechanism of plant non-specific phospholipase c 0.8418 42 358
2d1g-assembly1.cif.gz_A structure of francisella tularensis acid phosphatase a (acpa) bound to orthovanadate 0.7247 38 406
2d1g-assembly1.cif.gz_B structure of francisella tularensis acid phosphatase a (acpa) bound to orthovanadate 0.7131 38 406
8hav-assembly1.cif.gz_B an auto-activation mechanism of plant non-specific phospholipase c 0.6747 42 358
ID Description Score Start End Superfamily
af_P9WIB3_236_475_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7259 193 407 3.40.720.10
5venB01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.674 134 356 3.40.720.10
af_I6XVW9_41_489_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6694 263 358 3.40.720.10
2d1gB02 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6557 38 407 3.40.720.10
2gsnB01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6526 133 357 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A1Q6XF82-F1-model_v4 Phosphoesterase 0.9579 114 407 GO:0016788
AF-A0A1Q6XF82-F1-model_v4 Phosphoesterase 0.9547 114 407 GO:0016788
AF-A0A535QRP8-F1-model_v4 Alkaline phosphatase family protein 0.9545 77 407 GO:0016788
AF-A0A533VYS0-F1-model_v4 Alkaline phosphatase family protein 0.9353 42 361 GO:0016788
AF-A0A1Q7NAP3-F1-model_v4 Fibronectin type-III domain-containing protein 0.9326 42 359 GO:0016788

Feature Viewer

pLDDT pTM Quality
88.33 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map