F301489

General Info

Members Datasets Scaffolds Average Seq Length
196 131 196 132

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10418766|Ga0105247_104187662
Length 149
Sequence MARAVVIHAALELGRRMALETREEGCPVRSPRDVVAYFGPRMEDLPVEEFHVAVLDAQHRLERDVTVTRGLLSSSLVHPREVFREAIAERAAAVILVHNHPSGDPMPSADDRAVTEQLVAAGRLLDIPVHDHVIIGRGRYTSFAEAGLL

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
45 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
78 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
79 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
84 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
85 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
92 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
93 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
94 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
112 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
118 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
122 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
123 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
124 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
125 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
126 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
127 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
128 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
129 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
130 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
131 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25
Nodule 0
Rhizoplane 1.02
Rhizosphere 72.45
Stem 0
Stem Tuber 0
Unclassified 1.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10258996 3300003323 Bacteria 3052
2 Ga0065704_10445128 3300005289 Unclassified 710
3 Ga0070658_10002562 3300005327 Bacteria 15147
4 Ga0070676_10016456 3300005328 Bacteria 4090
5 Ga0070683_100651442 3300005329 Bacteria 1008
6 Ga0070690_100046259 3300005330 Bacteria 2766
7 Ga0068869_100739702 3300005334 Bacteria 841
8 Ga0070682_100436379 3300005337 Unclassified 999
9 Ga0068868_100754936 3300005338 Bacteria 874
10 Ga0070660_100045844 3300005339 Bacteria 3349
11 Ga0070660_100070275 3300005339 Bacteria 2732
12 Ga0070689_100159699 3300005340 Bacteria 1821
13 Ga0070692_10141196 3300005345 Bacteria 1363
14 Ga0070674_100207282 3300005356 Bacteria 1517
15 Ga0070673_100000780 3300005364 Bacteria 17715
16 Ga0070688_100208285 3300005365 Bacteria 1371
17 Ga0070659_100240430 3300005366 Bacteria 1498
18 Ga0070678_100004304 3300005456 Bacteria 8052
19 Ga0070685_10000786 3300005466 Bacteria 17226
20 Ga0070672_100054099 3300005543 Bacteria 3141
21 Ga0070672_100347271 3300005543 Bacteria 1264
22 Ga0070686_100004388 3300005544 Bacteria 7778
23 Ga0070665_100012616 3300005548 Bacteria 8508
24 Ga0070704_100720665 3300005549 Bacteria 886
25 Ga0068855_100000001 3300005563 Bacteria 818777
26 Ga0068855_100000136 3300005563 Bacteria 93608
27 Ga0068855_100222049 3300005563 Bacteria 2118
28 Ga0068855_100344615 3300005563 Bacteria 1642
29 Ga0068857_100000053 3300005577 Bacteria 63815
30 Ga0068857_100000506 3300005577 Bacteria 27957
31 Ga0068856_100002655 3300005614 Bacteria 18341
32 Ga0081455_10450428 3300005937 Unclassified 879
33 Ga0081455_10486765 3300005937 Bacteria 832
34 Ga0075365_10000186 3300006038 Bacteria 20358
35 Ga0075365_10023108 3300006038 Bacteria 3906
36 Ga0075364_10000907 3300006051 Bacteria 15646
37 Ga0075364_10055769 3300006051 Bacteria 2586
38 Ga0075364_10062626 3300006051 Bacteria 2441
39 Ga0075364_10144122 3300006051 Bacteria 1603
40 Ga0075364_10158508 3300006051 Bacteria 1527
41 Ga0075367_10000007 3300006178 Bacteria 45077
42 Ga0075367_10000302 3300006178 Bacteria 17379
43 Ga0075367_10014516 3300006178 Bacteria 4266
44 Ga0075369_10000001 3300006186 Bacteria 299616
45 Ga0075366_10000131 3300006195 Bacteria 31165
46 Ga0075366_10000225 3300006195 Bacteria 25114
47 Ga0075366_10000449 3300006195 Bacteria 19163
48 Ga0075366_10001085 3300006195 Bacteria 13364
49 Ga0097621_100192611 3300006237 Bacteria 1766
50 Ga0105240_10000003 3300009093 Bacteria 1183681
51 Ga0111539_11834930 3300009094 Bacteria 703
52 Ga0105245_10000002 3300009098 Bacteria 634374
53 Ga0105245_10001148 3300009098 Bacteria 23948
54 Ga0105247_10418766 3300009101 Bacteria 958
55 Ga0105243_10636044 3300009148 Bacteria 1032
56 Ga0105241_10000003 3300009174 Bacteria 839043
57 Ga0105241_10046464 3300009174 Bacteria 3297
58 Ga0105241_10086420 3300009174 Bacteria 2466
59 Ga0105241_10135193 3300009174 Bacteria 2001
60 Ga0105242_10000001 3300009176 Bacteria 574039
61 Ga0105242_10295336 3300009176 Bacteria 1477
62 Ga0105242_11785767 3300009176 Bacteria 653
63 Ga0105248_10376748 3300009177 Bacteria 1598
64 Ga0105237_10011153 3300009545 Bacteria 9527
65 Ga0105238_10893480 3300009551 Unclassified 907
66 Ga0105249_10000243 3300009553 Bacteria 60371
67 Ga0105029_116204 3300009984 Unclassified 603
68 Ga0105028_113634 3300009993 Unclassified 862
69 Ga0105239_10006998 3300010375 Bacteria 12982
70 Ga0105239_10014276 3300010375 Bacteria 8816
71 Ga0157373_10000042 3300013100 Bacteria 113564
72 Ga0157369_10001396 3300013105 Bacteria 29672
73 Ga0157374_10000176 3300013296 Bacteria 59289
74 Ga0157374_10000585 3300013296 Bacteria 32298
75 Ga0157374_10100324 3300013296 Bacteria 2775
76 Ga0157374_10292462 3300013296 Bacteria 1610
77 Ga0157374_10718366 3300013296 Bacteria 1013
78 Ga0157374_10927448 3300013296 Unclassified 889
79 Ga0157374_11396501 3300013296 Unclassified 723
80 Ga0157374_11927412 3300013296 Unclassified 617
81 Ga0157374_12357890 3300013296 Bacteria 559
82 Ga0157378_10003850 3300013297 Bacteria 13273
83 Ga0163162_10033209 3300013306 Bacteria 5127
84 Ga0157372_10122152 3300013307 Bacteria 2993
85 Ga0157377_10013539 3300014745 Unclassified 4130
86 Ga0157377_10646022 3300014745 Bacteria 761
87 Ga0157376_10057507 3300014969 Bacteria 3253
88 Ga0207645_10028878 3300025907 Bacteria 3578
89 Ga0207645_10097908 3300025907 Bacteria 1891
90 Ga0207705_10000161 3300025909 Bacteria 72047
91 Ga0207705_10006115 3300025909 Bacteria 8956
92 Ga0207654_10000002 3300025911 Bacteria 1460142
93 Ga0207654_10046064 3300025911 Bacteria 2485
94 Ga0207654_10072729 3300025911 Bacteria 2047
95 Ga0207695_10000005 3300025913 Bacteria 1196715
96 Ga0207671_10008887 3300025914 Bacteria 8459
97 Ga0207657_10079668 3300025919 Bacteria 2755
98 Ga0207657_10100805 3300025919 Bacteria 2397
99 Ga0207694_10791678 3300025924 Unclassified 801
100 Ga0207687_10000987 3300025927 Bacteria 19312
101 Ga0207690_10371246 3300025932 Bacteria 1135
102 Ga0207686_10000001 3300025934 Bacteria 1169580
103 Ga0207686_10034286 3300025934 Bacteria 3037
104 Ga0207686_10145445 3300025934 Bacteria 1643
105 Ga0207691_10059340 3300025940 Bacteria 3479
106 Ga0207689_10740570 3300025942 Unclassified 829
107 Ga0207661_10594498 3300025944 Bacteria 1015
108 Ga0207679_10684458 3300025945 Bacteria 930
109 Ga0207667_10000003 3300025949 Bacteria 822935
110 Ga0207667_10000060 3300025949 Bacteria 192320
111 Ga0207667_10166543 3300025949 Bacteria 2266
112 Ga0207667_10775332 3300025949 Bacteria 957
113 Ga0207651_10001121 3300025960 Bacteria 11934
114 Ga0207712_10000433 3300025961 Bacteria 35737
115 Ga0207702_10002557 3300026078 Bacteria 17127
116 Ga0207674_10000417 3300026116 Bacteria 55380
117 Ga0207674_10001347 3300026116 Bacteria 31764
118 Ga0207683_10010251 3300026121 Bacteria 7989
119 Ga0207683_11476686 3300026121 Bacteria 628
120 Ga0209813_10014035 3300027866 Bacteria 2149
121 Ga0268266_10010834 3300028379 Bacteria 7941
122 Ga0314311_1113626 3300030733 Unclassified 531
123 Ga0316183_1206611 3300030742 Bacteria 718
124 Ga0316182_1033731 3300030745 Bacteria 4114
125 Ga0316182_1258541 3300030745 Bacteria 3653
126 Ga0265328_10207513 3300031239 Bacteria 745
127 Ga0307516_10436095 3300031730 Bacteria 967
128 Ga0307413_10226265 3300031824 Bacteria 1370
129 Ga0373950_0153001 3300034818 Bacteria 529
130 Ga0373934_0337810 3300035086 Bacteria 626
131 Ga0373960_0192162 3300035121 Bacteria 718
132 Ga0373933_1056276 3300035724 Bacteria 535
133 Ga0373937_0455532 3300036401 Bacteria 1215
134 Ga0395900_0000001 3300037418 Bacteria 931146
135 Ga0395898_0000002 3300037466 Bacteria 931013
136 Ga0395901_0000072 3300038443 Bacteria 140394
137 Ga0451791_1122440 3300041451 Bacteria 566
138 Ga0451837_1225942 3300041494 Bacteria 609
139 Ga0439433_0158376 3300041999 Bacteria 585
140 Ga0439448_0304606 3300042005 Bacteria 566
141 Ga0466965_0666766 3300044683 Bacteria 595
142 Ga0453684_0752603 3300044712 Bacteria 1055
143 Ga0451576_0090593 3300045051 Bacteria 3181
144 Ga0466967_1052032 3300045976 Bacteria 811
145 Ga0495664_0726651 3300046477 Bacteria 586
146 Ga0495598_0261731 3300046537 Bacteria 644
147 Ga0495645_0413530 3300046543 Bacteria 857
148 Ga0495667_0368713 3300046559 Bacteria 906
149 Ga0495649_0000100 3300046694 Bacteria 75606
150 Ga0495604_0404076 3300047317 Bacteria 899
151 Ga0495636_0045136 3300047318 Bacteria 1836
152 Ga0495674_0530095 3300047319 Bacteria 939
153 Ga0495674_1282449 3300047319 Bacteria 550
154 Ga0495672_0000010 3300047320 Bacteria 545038
155 Ga0496113_1440507 3300048916 Bacteria 533
156 Ga0501039_1114134 3300049575 Bacteria 612
157 Ga0501042_1144655 3300049578 Bacteria 567
158 Ga0501216_166654 3300049660 Bacteria 531
159 Ga0501245_140199 3300049708 Unclassified 526
160 Ga0501080_1241585 3300049742 Bacteria 639
161 nmdc:mga00v17_29933_c1 3300050491 Bacteria 3198
162 nmdc:mga00v17_404_c1 3300050491 Bacteria 24413
163 nmdc:mga00v17_48031_c1 3300050491 Bacteria 2586
164 nmdc:mga00v17_51179_c2 3300050491 Bacteria 625
165 nmdc:mga00v17_54404_c1 3300050491 Bacteria 2441
166 nmdc:mga00v17_624127_c1 3300050491 Bacteria 694
167 nmdc:mga0yw44_16912_c1 3300050492 Bacteria 3953
168 nmdc:mga0yw44_549_c1 3300050492 Bacteria 13518
169 nmdc:mga0k408_1325_c1 3300050493 Bacteria 13378
170 nmdc:mga0k408_205_c1 3300050493 Bacteria 31476
171 nmdc:mga0k408_22425_c1 3300050493 Bacteria 3555
172 nmdc:mga0k408_311_c1 3300050493 Bacteria 26361
173 nmdc:mga0k408_648_c1 3300050493 Bacteria 19177
174 nmdc:mga06z11_104_c1 3300050494 Bacteria 35130
175 nmdc:mga06z11_1095_c1 3300050494 Bacteria 9882
176 nmdc:mga06z11_202_c1 3300050494 Bacteria 23914
177 nmdc:mga06z11_680_c1 3300050494 Bacteria 12359
178 nmdc:mga04h51_15393_c1 3300050495 Bacteria 2203
179 nmdc:mga04h51_37564_c1 3300050495 Bacteria 1564
180 nmdc:mga08x19_832718_c1 3300050514 Bacteria 655
181 nmdc:mga0a205_291755_c1 3300050515 Bacteria 1505
182 nmdc:mga0sz30_1655_c1 3300050516 Bacteria 7920
183 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
184 Ga0495595_0158594 3300053084 Bacteria 1116
185 Ga0500643_002167 3300053087 Bacteria 10400
186 Ga0500644_0013777 3300053088 Unclassified 2266
187 Ga0500644_0061433 3300053088 Bacteria 1325
188 Ga0500583_0060979 3300053092 Bacteria 1780
189 Ga0500651_0000019 3300053093 Bacteria 141974
190 Ga0500651_0000387 3300053093 Bacteria 24050
191 Ga0500566_0000001 3300053094 Bacteria 1101031
192 Ga0500594_0000001 3300053118 Bacteria 1178472
193 Ga0500594_0000468 3300053118 Bacteria 8886
194 Ga0500642_0004756 3300053130 Unclassified 4294
195 Ga0500577_0000119 3300053142 Bacteria 19073
196 Ga0500599_015993 3300053736 Bacteria 1033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10000417 Ga0207674_1000041758 115
2 3300005549 Ga0070704_100720665 Ga0070704_1007206652 121
3 3300025907 Ga0207645_10028878 Ga0207645_100288782 121
4 3300025934 Ga0207686_10034286 Ga0207686_100342862 121
5 3300031824 Ga0307413_10226265 Ga0307413_102262652 121
6 3300035121 Ga0373960_0192162 Ga0373960_0192162_299_667 121
7 3300041999 Ga0439433_0158376 Ga0439433_0158376_16_384 121
8 3300042005 Ga0439448_0304606 Ga0439448_0304606_18_386 121
9 3300046543 Ga0495645_0413530 Ga0495645_0413530_474_842 121
10 3300047319 Ga0495674_1282449 Ga0495674_1282449_15_383 121
11 3300048916 Ga0496113_1440507 Ga0496113_1440507_17_385 121
12 3300005339 Ga0070660_100045844 Ga0070660_1000458444 122
13 3300005345 Ga0070692_10141196 Ga0070692_101411962 122
14 3300005366 Ga0070659_100240430 Ga0070659_1002404302 122
15 3300025909 Ga0207705_10006115 Ga0207705_1000611512 122
16 3300025919 Ga0207657_10100805 Ga0207657_101008053 122
17 3300006051 Ga0075364_10158508 Ga0075364_101585082 125
18 3300006195 Ga0075366_10001085 Ga0075366_100010857 125
19 3300009993 Ga0105028_113634 Ga0105028_1136342 125
20 3300013296 Ga0157374_11927412 Ga0157374_119274121 125
21 3300050491 nmdc:mga00v17_29933_c1 nmdc:mga00v17_29933_c1_114_491 125
22 3300050493 nmdc:mga0k408_1325_c1 nmdc:mga0k408_1325_c1_10272_10649 125
23 3300050494 nmdc:mga06z11_104_c1 nmdc:mga06z11_104_c1_25468_25845 125
24 3300003323 rootH1_10258996 rootH1_102589964 127
25 3300005289 Ga0065704_10445128 Ga0065704_104451282 127
26 3300005327 Ga0070658_10002562 Ga0070658_100025622 127
27 3300005328 Ga0070676_10016456 Ga0070676_100164564 127
28 3300005329 Ga0070683_100651442 Ga0070683_1006514422 127
29 3300005330 Ga0070690_100046259 Ga0070690_1000462593 127
30 3300005334 Ga0068869_100739702 Ga0068869_1007397021 127
31 3300005337 Ga0070682_100436379 Ga0070682_1004363791 127
32 3300005338 Ga0068868_100754936 Ga0068868_1007549362 127
33 3300005339 Ga0070660_100070275 Ga0070660_1000702753 127
34 3300005340 Ga0070689_100159699 Ga0070689_1001596992 127
35 3300005356 Ga0070674_100207282 Ga0070674_1002072823 127
36 3300005364 Ga0070673_100000780 Ga0070673_10000078022 127
37 3300005365 Ga0070688_100208285 Ga0070688_1002082852 127
38 3300005456 Ga0070678_100004304 Ga0070678_1000043043 127
39 3300005466 Ga0070685_10000786 Ga0070685_1000078619 127
40 3300005543 Ga0070672_100054099 Ga0070672_1000540992 127
41 3300005543 Ga0070672_100347271 Ga0070672_1003472712 127
42 3300005544 Ga0070686_100004388 Ga0070686_1000043884 127
43 3300005548 Ga0070665_100012616 Ga0070665_1000126163 127
44 3300005563 Ga0068855_100000001 Ga0068855_100000001391 127
45 3300005563 Ga0068855_100000136 Ga0068855_10000013679 127
46 3300005563 Ga0068855_100222049 Ga0068855_1002220491 127
47 3300005563 Ga0068855_100344615 Ga0068855_1003446152 127
48 3300005577 Ga0068857_100000053 Ga0068857_10000005343 127
49 3300005577 Ga0068857_100000506 Ga0068857_10000050624 127
50 3300005614 Ga0068856_100002655 Ga0068856_1000026557 127
51 3300005937 Ga0081455_10450428 Ga0081455_104504282 127
52 3300005937 Ga0081455_10486765 Ga0081455_104867653 127
53 3300006038 Ga0075365_10000186 Ga0075365_1000018617 127
54 3300006038 Ga0075365_10023108 Ga0075365_100231087 127
55 3300006051 Ga0075364_10000907 Ga0075364_1000090717 127
56 3300006051 Ga0075364_10055769 Ga0075364_100557692 127
57 3300006051 Ga0075364_10062626 Ga0075364_100626265 127
58 3300006051 Ga0075364_10144122 Ga0075364_101441223 127
59 3300006178 Ga0075367_10000007 Ga0075367_1000000735 127
60 3300006178 Ga0075367_10000302 Ga0075367_1000030211 127
61 3300006178 Ga0075367_10014516 Ga0075367_100145168 127
62 3300006186 Ga0075369_10000001 Ga0075369_10000001308 127
63 3300006195 Ga0075366_10000131 Ga0075366_1000013133 127
64 3300006195 Ga0075366_10000225 Ga0075366_1000022524 127
65 3300006195 Ga0075366_10000449 Ga0075366_100004494 127
66 3300006237 Ga0097621_100192611 Ga0097621_1001926112 127
67 3300009093 Ga0105240_10000003 Ga0105240_10000003548 127
68 3300009094 Ga0111539_11834930 Ga0111539_118349301 127
69 3300009098 Ga0105245_10000002 Ga0105245_10000002130 127
70 3300009098 Ga0105245_10001148 Ga0105245_1000114815 127
71 3300009101 Ga0105247_10418766 Ga0105247_104187662 127
72 3300009148 Ga0105243_10636044 Ga0105243_106360442 127
73 3300009174 Ga0105241_10000003 Ga0105241_10000003709 127
74 3300009174 Ga0105241_10046464 Ga0105241_100464643 127
75 3300009174 Ga0105241_10086420 Ga0105241_100864205 127
76 3300009174 Ga0105241_10135193 Ga0105241_101351932 127
77 3300009176 Ga0105242_10000001 Ga0105242_10000001518 127
78 3300009176 Ga0105242_10295336 Ga0105242_102953362 127
79 3300009176 Ga0105242_11785767 Ga0105242_117857672 127
80 3300009177 Ga0105248_10376748 Ga0105248_103767481 127
81 3300009545 Ga0105237_10011153 Ga0105237_1001115310 127
82 3300009551 Ga0105238_10893480 Ga0105238_108934802 127
83 3300009553 Ga0105249_10000243 Ga0105249_1000024359 127
84 3300009984 Ga0105029_116204 Ga0105029_1162041 127
85 3300010375 Ga0105239_10006998 Ga0105239_100069984 127
86 3300010375 Ga0105239_10014276 Ga0105239_100142765 127
87 3300013100 Ga0157373_10000042 Ga0157373_1000004277 127
88 3300013105 Ga0157369_10001396 Ga0157369_100013969 127
89 3300013296 Ga0157374_10000176 Ga0157374_1000017628 127
90 3300013296 Ga0157374_10000585 Ga0157374_1000058517 127
91 3300013296 Ga0157374_10100324 Ga0157374_101003244 127
92 3300013296 Ga0157374_10292462 Ga0157374_102924623 127
93 3300013296 Ga0157374_10718366 Ga0157374_107183662 127
94 3300013296 Ga0157374_10927448 Ga0157374_109274482 127
95 3300013296 Ga0157374_11396501 Ga0157374_113965012 127
96 3300013296 Ga0157374_12357890 Ga0157374_123578901 127
97 3300013297 Ga0157378_10003850 Ga0157378_1000385021 127
98 3300013306 Ga0163162_10033209 Ga0163162_100332094 127
99 3300013307 Ga0157372_10122152 Ga0157372_101221522 127
100 3300014745 Ga0157377_10013539 Ga0157377_100135392 127
101 3300014745 Ga0157377_10646022 Ga0157377_106460222 127
102 3300014969 Ga0157376_10057507 Ga0157376_100575072 127
103 3300025907 Ga0207645_10097908 Ga0207645_100979082 127
104 3300025909 Ga0207705_10000161 Ga0207705_1000016119 127
105 3300025911 Ga0207654_10000002 Ga0207654_10000002499 127
106 3300025911 Ga0207654_10046064 Ga0207654_100460642 127
107 3300025911 Ga0207654_10072729 Ga0207654_100727292 127
108 3300025913 Ga0207695_10000005 Ga0207695_10000005557 127
109 3300025914 Ga0207671_10008887 Ga0207671_100088878 127
110 3300025919 Ga0207657_10079668 Ga0207657_100796684 127
111 3300025924 Ga0207694_10791678 Ga0207694_107916782 127
112 3300025927 Ga0207687_10000987 Ga0207687_1000098715 127
113 3300025932 Ga0207690_10371246 Ga0207690_103712462 127
114 3300025934 Ga0207686_10000001 Ga0207686_10000001401 127
115 3300025934 Ga0207686_10145445 Ga0207686_101454451 127
116 3300025940 Ga0207691_10059340 Ga0207691_100593404 127
117 3300025942 Ga0207689_10740570 Ga0207689_107405702 127
118 3300025944 Ga0207661_10594498 Ga0207661_105944982 127
119 3300025945 Ga0207679_10684458 Ga0207679_106844582 127
120 3300025949 Ga0207667_10000003 Ga0207667_10000003382 127
121 3300025949 Ga0207667_10000060 Ga0207667_10000060134 127
122 3300025949 Ga0207667_10166543 Ga0207667_101665433 127
123 3300025949 Ga0207667_10775332 Ga0207667_107753322 127
124 3300025960 Ga0207651_10001121 Ga0207651_100011213 127
125 3300025961 Ga0207712_10000433 Ga0207712_1000043321 127
126 3300026078 Ga0207702_10002557 Ga0207702_1000255715 127
127 3300026116 Ga0207674_10001347 Ga0207674_1000134719 127
128 3300026121 Ga0207683_10010251 Ga0207683_1001025110 127
129 3300026121 Ga0207683_11476686 Ga0207683_114766862 127
130 3300027866 Ga0209813_10014035 Ga0209813_100140353 127
131 3300028379 Ga0268266_10010834 Ga0268266_100108343 127
132 3300030733 Ga0314311_1113626 Ga0314311_11136261 127
133 3300030742 Ga0316183_1206611 Ga0316183_12066111 127
134 3300030745 Ga0316182_1033731 Ga0316182_10337312 127
135 3300030745 Ga0316182_1258541 Ga0316182_12585414 127
136 3300031239 Ga0265328_10207513 Ga0265328_102075132 127
137 3300031730 Ga0307516_10436095 Ga0307516_104360952 127
138 3300034818 Ga0373950_0153001 Ga0373950_0153001_24_473 127
139 3300035086 Ga0373934_0337810 Ga0373934_0337810_35_436 127
140 3300035724 Ga0373933_1056276 Ga0373933_1056276_84_485 127
141 3300036401 Ga0373937_0455532 Ga0373937_0455532_23_424 127
142 3300037418 Ga0395900_0000001 Ga0395900_0000001_868743_869195 127
143 3300037466 Ga0395898_0000002 Ga0395898_0000002_236811_237263 127
144 3300038443 Ga0395901_0000072 Ga0395901_0000072_74478_74930 127
145 3300041451 Ga0451791_1122440 Ga0451791_1122440_88_471 127
146 3300041494 Ga0451837_1225942 Ga0451837_1225942_160_561 127
147 3300044683 Ga0466965_0666766 Ga0466965_0666766_26_463 127
148 3300044712 Ga0453684_0752603 Ga0453684_0752603_189_590 127
149 3300045051 Ga0451576_0090593 Ga0451576_0090593_1140_1541 127
150 3300045976 Ga0466967_1052032 Ga0466967_1052032_28_429 127
151 3300046477 Ga0495664_0726651 Ga0495664_0726651_73_522 127
152 3300046537 Ga0495598_0261731 Ga0495598_0261731_23_460 127
153 3300046559 Ga0495667_0368713 Ga0495667_0368713_170_619 127
154 3300046694 Ga0495649_0000100 Ga0495649_0000100_6766_7155 127
155 3300047317 Ga0495604_0404076 Ga0495604_0404076_194_643 127
156 3300047318 Ga0495636_0045136 Ga0495636_0045136_1220_1621 127
157 3300047319 Ga0495674_0530095 Ga0495674_0530095_15_416 127
158 3300047320 Ga0495672_0000010 Ga0495672_0000010_241682_242092 127
159 3300049575 Ga0501039_1114134 Ga0501039_1114134_11_460 127
160 3300049578 Ga0501042_1144655 Ga0501042_1144655_28_429 127
161 3300049660 Ga0501216_166654 Ga0501216_166654_116_517 127
162 3300049708 Ga0501245_140199 Ga0501245_140199_46_447 127
163 3300049742 Ga0501080_1241585 Ga0501080_1241585_69_470 127
164 3300050491 nmdc:mga00v17_404_c1 nmdc:mga00v17_404_c1_23521_23949 127
165 3300050491 nmdc:mga00v17_48031_c1 nmdc:mga00v17_48031_c1_1328_1729 127
166 3300050491 nmdc:mga00v17_51179_c2 nmdc:mga00v17_51179_c2_152_574 127
167 3300050491 nmdc:mga00v17_54404_c1 nmdc:mga00v17_54404_c1_534_920 127
168 3300050491 nmdc:mga00v17_624127_c1 nmdc:mga00v17_624127_c1_146_529 127
169 3300050492 nmdc:mga0yw44_16912_c1 nmdc:mga0yw44_16912_c1_2411_2797 127
170 3300050492 nmdc:mga0yw44_549_c1 nmdc:mga0yw44_549_c1_7858_8286 127
171 3300050493 nmdc:mga0k408_205_c1 nmdc:mga0k408_205_c1_30130_30516 127
172 3300050493 nmdc:mga0k408_22425_c1 nmdc:mga0k408_22425_c1_305_688 127
173 3300050493 nmdc:mga0k408_311_c1 nmdc:mga0k408_311_c1_15041_15463 127
174 3300050493 nmdc:mga0k408_648_c1 nmdc:mga0k408_648_c1_13740_14123 127
175 3300050494 nmdc:mga06z11_1095_c1 nmdc:mga06z11_1095_c1_9324_9776 127
176 3300050494 nmdc:mga06z11_202_c1 nmdc:mga06z11_202_c1_20889_21272 127
177 3300050494 nmdc:mga06z11_680_c1 nmdc:mga06z11_680_c1_2927_3349 127
178 3300050495 nmdc:mga04h51_15393_c1 nmdc:mga04h51_15393_c1_157_579 127
179 3300050495 nmdc:mga04h51_37564_c1 nmdc:mga04h51_37564_c1_378_779 127
180 3300050514 nmdc:mga08x19_832718_c1 nmdc:mga08x19_832718_c1_14_544 127
181 3300050515 nmdc:mga0a205_291755_c1 nmdc:mga0a205_291755_c1_89_493 127
182 3300050516 nmdc:mga0sz30_1655_c1 nmdc:mga0sz30_1655_c1_5624_6013 127
183 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_445889_446272 127
184 3300053084 Ga0495595_0158594 Ga0495595_0158594_27_428 127
185 3300053087 Ga0500643_002167 Ga0500643_002167_6101_6484 127
186 3300053088 Ga0500644_0013777 Ga0500644_0013777_1326_1709 127
187 3300053088 Ga0500644_0061433 Ga0500644_0061433_408_794 127
188 3300053092 Ga0500583_0060979 Ga0500583_0060979_678_1094 127
189 3300053093 Ga0500651_0000019 Ga0500651_0000019_6119_6502 127
190 3300053093 Ga0500651_0000387 Ga0500651_0000387_7704_8087 127
191 3300053094 Ga0500566_0000001 Ga0500566_0000001_910958_911344 127
192 3300053118 Ga0500594_0000001 Ga0500594_0000001_861550_861966 127
193 3300053118 Ga0500594_0000468 Ga0500594_0000468_1177_1560 127
194 3300053130 Ga0500642_0004756 Ga0500642_0004756_244_627 127
195 3300053142 Ga0500577_0000119 Ga0500577_0000119_3945_4361 127
196 3300053736 Ga0500599_015993 Ga0500599_015993_454_840 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04002

RadC

RadC-like JAB domain

28

148

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qlc-assembly5.cif.gz_E the crystal structure of dna repair protein radc from chlorobium tepidum tls 0.896 5 127
2qlc-assembly5.cif.gz_E the crystal structure of dna repair protein radc from chlorobium tepidum tls 0.8826 5 127
6lnw-assembly1.cif.gz_C crystal structure of accessory secretory protein 1,2 and 3 in streptococcus pneumoniae 0.8381 26 44
5vae-assembly1.cif.gz_B crystal structure of accessory secretion protein 1 and 3 0.8026 23 44
7bhq-assembly1.cif.gz_A in situ assembled salmonella flgd hook cap complex 0.8013 25 47
ID Description Score Start End Superfamily
af_Q47685_35_158_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9632 5 127 3.40.140.10
af_P25531_100_221_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9596 6 125 3.40.140.10
af_Q47685_35_158_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9482 5 127 3.40.140.10
af_P31337_89_213_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9433 6 124 3.40.140.10
af_P25531_100_221_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9369 6 125 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A3C0SWF5-F1-model_v4 MPN domain-containing protein 0.9898 5 127 GO:0006508
GO:0008237
GO:0046872
AF-A0A8A3SA95-F1-model_v4 DNA repair protein RadC 0.9886 6 127 GO:0006508
GO:0008237
GO:0046872
AF-A0A6I7QT83-F1-model_v4 DNA repair protein RadC 0.9886 6 127 GO:0006508
GO:0008237
GO:0046872
AF-A0A843KGY2-F1-model_v4 DNA repair protein RadC 0.9877 6 127 GO:0006508
GO:0008237
GO:0046872
AF-A0A1F7FEM6-F1-model_v4 MPN domain-containing protein 0.9875 6 123 GO:0006508
GO:0008237
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.96 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map