F301475

General Info

Members Datasets Scaffolds Average Seq Length
196 134 388 140

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10398925|Ga0111539_103989251
Length 163
Sequence MGMNSSLENLIDSNSTTKNLQMKFRLLLSFLLLTASVAAFGQEKQSRKSKKQNSAVAEKGLVKVSVMYPFAEGKTFNMEYYETTHMPMVAKFLGSNLVKYTIEKGVASGIPNQPLPYMAIGTFYVKSLEEYQAAIGPNRDAIRADFVNYTNTVPVILVSEVVR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
77 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
78 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
79 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
80 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
81 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
82 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
92 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
93 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
94 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
99 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
103 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
106 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
107 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
110 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
111 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
112 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
113 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
114 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
115 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
116 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
117 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
118 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
119 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
120 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
121 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
127 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
128 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
129 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
130 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
132 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
133 2738541283 Pedobacter sp. OK701 Isolate Unclassified
134 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 0.51
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.22
Nodule 0
Rhizoplane 0.51
Rhizosphere 76.02
Stem 0
Stem Tuber 0
Unclassified 11.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10398925 3300009094 Bacteria 1602
2 JGI24737J22298_10000022 3300001990 Bacteria 45529
3 JGI24735J21928_10000031 3300002067 Bacteria 75354
4 rootH1_10032750 3300003316 Bacteria 1089
5 rootH1_10192705 3300003316 Bacteria 1480
6 rootL2_10002364 3300003322 Bacteria 8173
7 rootL2_10017524 3300003322 Bacteria 11807
8 rootL2_10117048 3300003322 Bacteria 4223
9 rootL2_10146316 3300003322 Bacteria 1802
10 rootL2_10218482 3300003322 Bacteria 6896
11 rootL2_10266556 3300003322 Bacteria 2379
12 rootH1_10001709 3300003323 Bacteria 22803
13 rootH1_10055868 3300003323 Bacteria 6902
14 rootH1_10081164 3300003323 Bacteria 16999
15 Ga0055531_10000056 3300003794 Bacteria 123579
16 Ga0055543_1057523 3300004625 Unclassified 628
17 Ga0065165_1000639 3300005262 Bacteria 50701
18 Ga0065165_1000981 3300005262 Bacteria 35359
19 Ga0068869_101402378 3300005334 Unclassified 618
20 Ga0070666_10006474 3300005335 Bacteria 7201
21 Ga0070682_100161988 3300005337 Bacteria 1546
22 Ga0070660_100238808 3300005339 Bacteria 1480
23 Ga0070660_100995348 3300005339 Bacteria 708
24 Ga0070674_100054177 3300005356 Bacteria 2773
25 Ga0070679_101226571 3300005530 Bacteria 695
26 Ga0068853_100210446 3300005539 Bacteria 1772
27 Ga0068853_100347054 3300005539 Bacteria 1380
28 Ga0068853_100467468 3300005539 Unclassified 1188
29 Ga0070665_100232858 3300005548 Bacteria 1842
30 Ga0070665_100476526 3300005548 Bacteria 1259
31 Ga0068855_100015301 3300005563 Bacteria 9236
32 Ga0068856_100161032 3300005614 Bacteria 2254
33 Ga0068852_100105474 3300005616 Bacteria 2553
34 Ga0068852_100238105 3300005616 Bacteria 1738
35 Ga0068859_100488722 3300005617 Bacteria 1326
36 Ga0068864_100188225 3300005618 Bacteria 1891
37 Ga0068864_101659355 3300005618 Bacteria 644
38 Ga0068863_100034500 3300005841 Bacteria 4820
39 Ga0068863_100955736 3300005841 Unclassified 858
40 Ga0068860_100000052 3300005843 Bacteria 207351
41 Ga0068860_100000053 3300005843 Bacteria 207331
42 Ga0068862_100158296 3300005844 Unclassified 2020
43 Ga0068862_100332280 3300005844 Bacteria 1406
44 Ga0068862_100418262 3300005844 Bacteria 1257
45 Ga0075366_10000532 3300006195 Bacteria 17678
46 Ga0097621_100081436 3300006237 Bacteria 2694
47 Ga0075370_10458690 3300006353 Bacteria 767
48 Ga0075370_10552733 3300006353 Bacteria 696
49 Ga0068871_100105088 3300006358 Bacteria 2369
50 Ga0075428_100080070 3300006844 Bacteria 3564
51 Ga0075430_100066248 3300006846 Bacteria 3033
52 Ga0097620_100488678 3300006931 Bacteria 1326
53 Ga0105240_10000093 3300009093 Bacteria 181967
54 Ga0105240_10007231 3300009093 Bacteria 16160
55 Ga0105240_10041185 3300009093 Bacteria 5899
56 Ga0105241_10030452 3300009174 Bacteria 4033
57 Ga0105241_10168029 3300009174 Bacteria 1809
58 Ga0105241_10244534 3300009174 Bacteria 1518
59 Ga0105237_10001314 3300009545 Bacteria 33011
60 Ga0105237_10049925 3300009545 Bacteria 4204
61 Ga0105238_10369705 3300009551 Bacteria 1424
62 Ga0105249_13134466 3300009553 Unclassified 531
63 Ga0105239_10000084 3300010375 Bacteria 130978
64 Ga0105239_10001757 3300010375 Bacteria 28561
65 Ga0105239_10004904 3300010375 Bacteria 15829
66 Ga0105239_11597280 3300010375 Bacteria 754
67 Ga0157371_10079269 3300013102 Bacteria 2326
68 Ga0157371_10171120 3300013102 Bacteria 1552
69 Ga0157370_10060549 3300013104 Bacteria 3594
70 Ga0157370_10153976 3300013104 Bacteria 2139
71 Ga0157370_10343799 3300013104 Bacteria 1375
72 Ga0157369_10158283 3300013105 Bacteria 2392
73 Ga0157369_10508410 3300013105 Bacteria 1246
74 Ga0157369_11607696 3300013105 Unclassified 661
75 Ga0157374_11804560 3300013296 Bacteria 637
76 Ga0157378_10179614 3300013297 Bacteria 1990
77 Ga0163162_10000300 3300013306 Bacteria 45491
78 Ga0163162_10002436 3300013306 Bacteria 17538
79 Ga0157372_10000555 3300013307 Bacteria 41074
80 Ga0157372_10120767 3300013307 Bacteria 3009
81 Ga0157372_10537407 3300013307 Bacteria 1363
82 Ga0157380_11242189 3300014326 Bacteria 790
83 Ga0157380_12724188 3300014326 Bacteria 561
84 Ga0157379_10656153 3300014968 Bacteria 982
85 Ga0154015_1041490 3300020610 Bacteria 600
86 Ga0209455_1000945 3300025272 Bacteria 14885
87 Ga0209676_1000488 3300025292 Bacteria 64408
88 Ga0209050_1001087 3300025298 Bacteria 33136
89 Ga0209050_1021990 3300025298 Bacteria 2302
90 Ga0207426_1054512 3300025302 Bacteria 1176
91 Ga0209257_1000077 3300025304 Bacteria 317964
92 Ga0207680_11148244 3300025903 Bacteria 555
93 Ga0207647_10047532 3300025904 Bacteria 2668
94 Ga0207654_10240467 3300025911 Unclassified 1210
95 Ga0207695_10000135 3300025913 Bacteria 217822
96 Ga0207695_10002235 3300025913 Bacteria 29044
97 Ga0207695_10030507 3300025913 Bacteria 5934
98 Ga0207671_10010553 3300025914 Bacteria 7606
99 Ga0207671_10314154 3300025914 Bacteria 1239
100 Ga0207669_10450839 3300025937 Bacteria 1019
101 Ga0207691_11435995 3300025940 Bacteria 566
102 Ga0207639_10115697 3300026041 Bacteria 2194
103 Ga0207639_10693070 3300026041 Bacteria 945
104 Ga0207639_11052653 3300026041 Bacteria 763
105 Ga0207702_10144561 3300026078 Bacteria 2156
106 Ga0207641_10198085 3300026088 Bacteria 1850
107 Ga0207675_100878775 3300026118 Bacteria 912
108 Ga0207698_10072991 3300026142 Bacteria 2730
109 Ga0207698_11517653 3300026142 Bacteria 685
110 Ga0207428_10166477 3300027907 Bacteria 1671
111 Ga0268266_10298897 3300028379 Bacteria 1501
112 Ga0268266_10433690 3300028379 Unclassified 1247
113 Ga0268265_10040652 3300028380 Bacteria 3436
114 Ga0268265_10447755 3300028380 Unclassified 1205
115 Ga0268264_10000098 3300028381 Bacteria 229055
116 Ga0268264_10000143 3300028381 Bacteria 170031
117 Ga0307515_10000510 3300028794 Bacteria 92702
118 Ga0307515_10003635 3300028794 Bacteria 32403
119 Ga0307515_10174874 3300028794 Bacteria 2122
120 Ga0316176_1177032 3300030732 Bacteria 13943
121 Ga0265327_10000609 3300031251 Bacteria 59168
122 Ga0307513_10080788 3300031456 Bacteria 3352
123 Ga0307513_10090806 3300031456 Bacteria 3114
124 Ga0307509_10051004 3300031507 Bacteria 4428
125 Ga0307509_10140825 3300031507 Bacteria 2348
126 Ga0307509_10432728 3300031507 Bacteria 1014
127 Ga0307413_10686579 3300031824 Bacteria 849
128 Ga0451787_837048 3300041441 Unclassified 847
129 Ga0451835_0820157 3300041492 Bacteria 572
130 Ga0451849_0145523 3300041505 Bacteria 939
131 Ga0451851_0044591 3300041507 Bacteria 701
132 Ga0450893_0135747 3300042532 Unclassified 522
133 Ga0466972_0000019 3300044658 Bacteria 198523
134 Ga0466972_0003246 3300044658 Bacteria 8062
135 Ga0466968_0051572 3300044735 Unclassified 1758
136 Ga0466970_0009240 3300044765 Bacteria 4976
137 Ga0466957_0928854 3300044842 Bacteria 623
138 Ga0466967_1777312 3300045976 Bacteria 614
139 Ga0495638_0000020 3300046460 Bacteria 372434
140 Ga0495651_0088771 3300046462 Bacteria 2323
141 Ga0495651_0110881 3300046462 Bacteria 2029
142 Ga0495585_0064865 3300046492 Bacteria 2002
143 Ga0495596_0033303 3300046500 Bacteria 2050
144 Ga0495610_0000566 3300046512 Bacteria 36944
145 Ga0495637_0102517 3300046520 Bacteria 1117
146 Ga0495644_0005228 3300046523 Bacteria 5075
147 Ga0495648_0028125 3300046524 Bacteria 3749
148 Ga0495642_0084943 3300046528 Bacteria 1336
149 Ga0495642_0086755 3300046528 Bacteria 1322
150 Ga0495652_0121987 3300046529 Bacteria 2077
151 Ga0495654_0054254 3300046530 Bacteria 1945
152 Ga0495586_0356962 3300046535 Bacteria 840
153 Ga0495609_0005647 3300046538 Bacteria 6520
154 Ga0495633_0000466 3300046558 Bacteria 41439
155 Ga0495633_0002771 3300046558 Bacteria 12121
156 Ga0495668_0000011 3300046616 Bacteria 472186
157 Ga0495668_0385331 3300046616 Bacteria 770
158 Ga0495625_0000660 3300046660 Bacteria 49270
159 Ga0495625_0002039 3300046660 Bacteria 22734
160 Ga0495625_0339007 3300046660 Bacteria 953
161 Ga0495661_0034660 3300046665 Bacteria 3174
162 Ga0495589_0381395 3300046794 Bacteria 648
163 Ga0495600_0055157 3300046809 Bacteria 2596
164 Ga0495687_000006 3300047443 Bacteria 571936
165 Ga0495685_022788 3300047447 Bacteria 2155
166 Ga0495614_0071072 3300048089 Bacteria 1500
167 Ga0496126_0114909 3300048929 Bacteria 2341
168 Ga0501300_000387 3300049523 Bacteria 6753
169 Ga0501199_015093 3300049650 Unclassified 862
170 Ga0501207_043959 3300049654 Bacteria 783
171 Ga0501223_143439 3300049663 Unclassified 515
172 Ga0501242_000216 3300049674 Unclassified 4456
173 Ga0501247_004947 3300049677 Bacteria 1474
174 Ga0501249_034881 3300049679 Bacteria 1129
175 Ga0501257_000596 3300049686 Bacteria 7151
176 Ga0501257_000745 3300049686 Bacteria 6482
177 Ga0501259_046996 3300049688 Bacteria 866
178 Ga0501225_0003654 3300049705 Bacteria 4631
179 Ga0501264_000501 3300049761 Bacteria 5809
180 nmdc:mga0k408_727_c1 3300050493 Bacteria 18063
181 nmdc:mga07m45_510544_c1 3300050496 Bacteria 696
182 nmdc:mga09592_890792_c1 3300050508 Unclassified 748
183 nmdc:mga0qj67_434440_c1 3300050509 Unclassified 1058
184 nmdc:mga06r32_702257_c1 3300050510 Unclassified 977
185 nmdc:mga08y16_1350911_c1 3300050511 Unclassified 678
186 Ga0500647_0152844 3300053091 Bacteria 1076
187 Ga0500608_001057 3300053122 Bacteria 9873
188 Ga0500614_023601 3300053123 Bacteria 1447
189 Ga0500618_059547 3300053125 Bacteria 859
190 Ga0500655_017919 3300053133 Unclassified 1313
191 Ga0500616_0000004 3300053153 Bacteria 1002714
192 Ga0500637_0454883 3300053178 Unclassified 648
193 2738757914 2738541283 Bacteria 7222293
194 2919696506 2919692658 Bacteria 5943958
195 Ga0111539_10398925
196 JGI24737J22298_10000022
197 JGI24735J21928_10000031
198 rootH1_10032750
199 rootH1_10192705
200 rootL2_10002364
201 rootL2_10017524
202 rootL2_10117048
203 rootL2_10146316
204 rootL2_10218482
205 rootL2_10266556
206 rootH1_10001709
207 rootH1_10055868
208 rootH1_10081164
209 Ga0055531_10000056
210 Ga0055543_1057523
211 Ga0065165_1000639
212 Ga0065165_1000981
213 Ga0068869_101402378
214 Ga0070666_10006474
215 Ga0070682_100161988
216 Ga0070660_100238808
217 Ga0070660_100995348
218 Ga0070674_100054177
219 Ga0070679_101226571
220 Ga0068853_100210446
221 Ga0068853_100347054
222 Ga0068853_100467468
223 Ga0070665_100232858
224 Ga0070665_100476526
225 Ga0068855_100015301
226 Ga0068856_100161032
227 Ga0068852_100105474
228 Ga0068852_100238105
229 Ga0068859_100488722
230 Ga0068864_100188225
231 Ga0068864_101659355
232 Ga0068863_100034500
233 Ga0068863_100955736
234 Ga0068860_100000052
235 Ga0068860_100000053
236 Ga0068862_100158296
237 Ga0068862_100332280
238 Ga0068862_100418262
239 Ga0075366_10000532
240 Ga0097621_100081436
241 Ga0075370_10458690
242 Ga0075370_10552733
243 Ga0068871_100105088
244 Ga0075428_100080070
245 Ga0075430_100066248
246 Ga0097620_100488678
247 Ga0105240_10000093
248 Ga0105240_10007231
249 Ga0105240_10041185
250 Ga0105241_10030452
251 Ga0105241_10168029
252 Ga0105241_10244534
253 Ga0105237_10001314
254 Ga0105237_10049925
255 Ga0105238_10369705
256 Ga0105249_13134466
257 Ga0105239_10000084
258 Ga0105239_10001757
259 Ga0105239_10004904
260 Ga0105239_11597280
261 Ga0157371_10079269
262 Ga0157371_10171120
263 Ga0157370_10060549
264 Ga0157370_10153976
265 Ga0157370_10343799
266 Ga0157369_10158283
267 Ga0157369_10508410
268 Ga0157369_11607696
269 Ga0157374_11804560
270 Ga0157378_10179614
271 Ga0163162_10000300
272 Ga0163162_10002436
273 Ga0157372_10000555
274 Ga0157372_10120767
275 Ga0157372_10537407
276 Ga0157380_11242189
277 Ga0157380_12724188
278 Ga0157379_10656153
279 Ga0154015_1041490
280 Ga0209455_1000945
281 Ga0209676_1000488
282 Ga0209050_1001087
283 Ga0209050_1021990
284 Ga0207426_1054512
285 Ga0209257_1000077
286 Ga0207680_11148244
287 Ga0207647_10047532
288 Ga0207654_10240467
289 Ga0207695_10000135
290 Ga0207695_10002235
291 Ga0207695_10030507
292 Ga0207671_10010553
293 Ga0207671_10314154
294 Ga0207669_10450839
295 Ga0207691_11435995
296 Ga0207639_10115697
297 Ga0207639_10693070
298 Ga0207639_11052653
299 Ga0207702_10144561
300 Ga0207641_10198085
301 Ga0207675_100878775
302 Ga0207698_10072991
303 Ga0207698_11517653
304 Ga0207428_10166477
305 Ga0268266_10298897
306 Ga0268266_10433690
307 Ga0268265_10040652
308 Ga0268265_10447755
309 Ga0268264_10000098
310 Ga0268264_10000143
311 Ga0307515_10000510
312 Ga0307515_10003635
313 Ga0307515_10174874
314 Ga0316176_1177032
315 Ga0265327_10000609
316 Ga0307513_10080788
317 Ga0307513_10090806
318 Ga0307509_10051004
319 Ga0307509_10140825
320 Ga0307509_10432728
321 Ga0307413_10686579
322 Ga0451787_837048
323 Ga0451835_0820157
324 Ga0451849_0145523
325 Ga0451851_0044591
326 Ga0450893_0135747
327 Ga0466972_0000019
328 Ga0466972_0003246
329 Ga0466968_0051572
330 Ga0466970_0009240
331 Ga0466957_0928854
332 Ga0466967_1777312
333 Ga0495638_0000020
334 Ga0495651_0088771
335 Ga0495651_0110881
336 Ga0495585_0064865
337 Ga0495596_0033303
338 Ga0495610_0000566
339 Ga0495637_0102517
340 Ga0495644_0005228
341 Ga0495648_0028125
342 Ga0495642_0084943
343 Ga0495642_0086755
344 Ga0495652_0121987
345 Ga0495654_0054254
346 Ga0495586_0356962
347 Ga0495609_0005647
348 Ga0495633_0000466
349 Ga0495633_0002771
350 Ga0495668_0000011
351 Ga0495668_0385331
352 Ga0495625_0000660
353 Ga0495625_0002039
354 Ga0495625_0339007
355 Ga0495661_0034660
356 Ga0495589_0381395
357 Ga0495600_0055157
358 Ga0495687_000006
359 Ga0495685_022788
360 Ga0495614_0071072
361 Ga0496126_0114909
362 Ga0501300_000387
363 Ga0501199_015093
364 Ga0501207_043959
365 Ga0501223_143439
366 Ga0501242_000216
367 Ga0501247_004947
368 Ga0501249_034881
369 Ga0501257_000596
370 Ga0501257_000745
371 Ga0501259_046996
372 Ga0501225_0003654
373 Ga0501264_000501
374 nmdc:mga0k408_727_c1
375 nmdc:mga07m45_510544_c1
376 nmdc:mga09592_890792_c1
377 nmdc:mga0qj67_434440_c1
378 nmdc:mga06r32_702257_c1
379 nmdc:mga08y16_1350911_c1
380 Ga0500647_0152844
381 Ga0500608_001057
382 Ga0500614_023601
383 Ga0500618_059547
384 Ga0500655_017919
385 Ga0500616_0000004
386 Ga0500637_0454883
387 2738757914
388 2919696506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07110

EthD

EthD domain

74

152

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bf4-assembly1.cif.gz_B crystal structure of an ethd-like protein (reut_b5694) from ralstonia eutropha jmp134 at 2.10 a resolution 0.9297 31 135
3bf4-assembly1.cif.gz_B crystal structure of an ethd-like protein (reut_b5694) from ralstonia eutropha jmp134 at 2.10 a resolution 0.8745 31 135
2ftr-assembly1.cif.gz_B crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution 0.7415 33 133
2ftr-assembly1.cif.gz_B crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution 0.7227 33 133
2ril-assembly1.cif.gz_A-2 crystal structure of a putative monooxygenase (yp_001095275.1) from shewanella loihica pv-4 at 1.26 a resolution 0.7176 32 135
ID Description Score Start End Superfamily
3bf4B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9088 35 132 3.30.70.100
3bf4B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.891 35 132 3.30.70.100
af_Q9FK81_1_111_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6887 31 133 3.30.70.100
af_P9WLA3_28_227_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6815 31 135 3.30.70.100
5b0bD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6777 33 135 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A0Q5TC86-F1-model_v4 Ethyl tert-butyl ether degradation protein EthD 0.9658 39 135 GO:0016491
AF-A0A0Q5TC86-F1-model_v4 Ethyl tert-butyl ether degradation protein EthD 0.9562 39 135 GO:0016491
AF-A0A0A1YQL6-F1-model_v4 Ethyl tert-butyl ether degradation protein EthD 0.9452 34 133 GO:0016491
AF-A0A6P0DVH8-F1-model_v4 EthD family reductase 0.9448 35 97 GO:0016491
AF-A0A1V0KMQ0-F1-model_v4 deleted 0.9416 34 133

Map