F301279

General Info

Members Datasets Scaffolds Average Seq Length
196 155 188 337

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100089782|Ga0070664_1000897822
Length 362
Sequence VSCVAELSATRSAAGESAAQAFAEGSPRVIVAGATGFAGALAAHLLWRHPRFELVAATGRSELGRRLDDLYPRYRVPLPIGELELDAYGQLDAAVVAYPHAAAAPAVGELRDRGARVVDLSADFRLSSLATYERWYGKHPRPDLLADAVYGLTELHRDQIAGAAIVANPGCYPTASLLGLAPLARAGLIADVVIDAKQGISGAGRAFDETTHQSMAGETILPYKVAEHRHTPEIEEQLAPLRKAAGANDEVAVLFQAHLVPLDQGELADCYVTTTRRVGDAELSDLMLAAYEQEPFVEVVGTPPGTREVQGTNFCRVFAKADPHSGKVVVLSALDNLWKGTSSQAVQNLNVMFDMPETEGLA

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
3 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
4 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
5 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
6 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
7 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
8 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
87 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
88 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
154 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.92
Metatranscriptomes 0
Isolates 4.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.61
Nodule 0.51
Rhizoplane 9.69
Rhizosphere 81.12
Stem 0
Stem Tuber 0
Unclassified 3.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10000273 3300002239 Bacteria 6812
2 Ga0070683_100100163 3300005329 Bacteria 2727
3 Ga0070670_100177218 3300005331 Bacteria 1850
4 Ga0070682_100000093 3300005337 Bacteria 81568
5 Ga0070689_100029995 3300005340 Bacteria 4124
6 Ga0070689_100110043 3300005340 Bacteria 2190
7 Ga0070669_100051257 3300005353 Bacteria 3016
8 Ga0070674_100163499 3300005356 Bacteria 1691
9 Ga0070688_100025235 3300005365 Bacteria 3517
10 Ga0070659_100005838 3300005366 Bacteria 8869
11 Ga0070711_100003627 3300005439 Bacteria 9019
12 Ga0070711_100011904 3300005439 Bacteria 5413
13 Ga0070711_100017952 3300005439 Bacteria 4511
14 Ga0070700_100230851 3300005441 Bacteria 1317
15 Ga0070663_100096059 3300005455 Bacteria 2204
16 Ga0070678_100180380 3300005456 Bacteria 1728
17 Ga0070684_100058569 3300005535 Bacteria 3367
18 Ga0070684_100086443 3300005535 Bacteria 2783
19 Ga0070664_100089782 3300005564 Bacteria 2659
20 Ga0068857_100330510 3300005577 Bacteria 1409
21 Ga0068854_100035395 3300005578 Bacteria 3494
22 Ga0070702_100004093 3300005615 Bacteria 6616
23 Ga0068864_100123823 3300005618 Bacteria 2314
24 Ga0068864_100210883 3300005618 Bacteria 1788
25 Ga0068866_10110140 3300005718 Bacteria 1535
26 Ga0068861_100006859 3300005719 Bacteria 7776
27 Ga0068861_100104202 3300005719 Bacteria 2263
28 Ga0068858_100284203 3300005842 Bacteria 1576
29 Ga0068860_100272673 3300005843 Bacteria 1652
30 Ga0081455_10021642 3300005937 Bacteria 6025
31 Ga0081455_10064984 3300005937 Bacteria 3054
32 Ga0081455_10114319 3300005937 Bacteria 2139
33 Ga0081538_10001862 3300005981 Bacteria 21272
34 Ga0081540_1004278 3300005983 Bacteria 10950
35 Ga0081539_10004153 3300005985 Bacteria 16452
36 Ga0081539_10006125 3300005985 Bacteria 11721
37 Ga0075365_10000154 3300006038 Bacteria 21818
38 Ga0075365_10011324 3300006038 Bacteria 5241
39 Ga0075365_10046854 3300006038 Bacteria 2841
40 Ga0075363_100019592 3300006048 Bacteria 3384
41 Ga0075364_10017023 3300006051 Bacteria 4532
42 Ga0075364_10177469 3300006051 Bacteria 1441
43 Ga0070716_100017948 3300006173 Bacteria 3679
44 Ga0070716_100118152 3300006173 Bacteria 1655
45 Ga0075430_100002391 3300006846 Bacteria 15602
46 Ga0075430_100036296 3300006846 Bacteria 4180
47 Ga0075431_100089987 3300006847 Bacteria 3168
48 Ga0075431_100181810 3300006847 Bacteria 2158
49 Ga0075429_100028037 3300006880 Bacteria 4887
50 Ga0068865_100140619 3300006881 Bacteria 1819
51 Ga0105240_10049764 3300009093 Bacteria 5287
52 Ga0105245_10065335 3300009098 Bacteria 3290
53 Ga0114129_10130566 3300009147 Bacteria 3451
54 Ga0105243_10316939 3300009148 Bacteria 1419
55 Ga0105237_10000228 3300009545 Bacteria 79622
56 Ga0105238_10477523 3300009551 Bacteria 1246
57 Ga0105239_10102145 3300010375 Bacteria 3173
58 Ga0105239_10146457 3300010375 Bacteria 2634
59 Ga0105239_10163679 3300010375 Bacteria 2487
60 Ga0157370_10412665 3300013104 Bacteria 1242
61 Ga0157375_10294716 3300013308 Bacteria 1785
62 Ga0157380_10066959 3300014326 Bacteria 2890
63 Ga0157377_10008285 3300014745 Bacteria 5064
64 Ga0157377_10168876 3300014745 Bacteria 1366
65 Ga0157376_10399679 3300014969 Bacteria 1328
66 Ga0209675_1025569 3300025291 Bacteria 1486
67 Ga0207642_10015495 3300025899 Bacteria 2842
68 Ga0207688_10047411 3300025901 Bacteria 2399
69 Ga0207695_10036759 3300025913 Bacteria 5290
70 Ga0207671_10000406 3300025914 Bacteria 60268
71 Ga0207693_10015425 3300025915 Bacteria 6129
72 Ga0207663_10162701 3300025916 Bacteria 1577
73 Ga0207657_10053694 3300025919 Bacteria 3490
74 Ga0207687_10016579 3300025927 Bacteria 4839
75 Ga0207687_10021537 3300025927 Bacteria 4284
76 Ga0207706_10238628 3300025933 Bacteria 1589
77 Ga0207686_10195334 3300025934 Bacteria 1445
78 Ga0207670_10329409 3300025936 Bacteria 1204
79 Ga0207704_10147557 3300025938 Bacteria 1655
80 Ga0207665_10039562 3300025939 Bacteria 3144
81 Ga0207691_10083667 3300025940 Bacteria 2865
82 Ga0207711_10105674 3300025941 Bacteria 2497
83 Ga0207689_10055192 3300025942 Bacteria 3270
84 Ga0207661_10166708 3300025944 Bacteria 1915
85 Ga0207661_10396924 3300025944 Bacteria 1250
86 Ga0207679_10080669 3300025945 Bacteria 2485
87 Ga0207703_10083447 3300026035 Bacteria 2670
88 Ga0207703_10155019 3300026035 Bacteria 2001
89 Ga0207703_10307412 3300026035 Bacteria 1448
90 Ga0207678_10327244 3300026067 Bacteria 1319
91 Ga0207708_10044145 3300026075 Bacteria 3396
92 Ga0207702_10276834 3300026078 Bacteria 1585
93 Ga0207641_10135440 3300026088 Bacteria 2217
94 Ga0207648_10147271 3300026089 Bacteria 2077
95 Ga0207676_10088185 3300026095 Bacteria 2539
96 Ga0207675_100021289 3300026118 Bacteria 6039
97 Ga0207675_100098311 3300026118 Bacteria 2756
98 Ga0207683_10280681 3300026121 Bacteria 1522
99 Ga0207698_10351701 3300026142 Bacteria 1392
100 Ga0268266_10173255 3300028379 Bacteria 1960
101 Ga0265337_1002022 3300028556 Bacteria 9625
102 Ga0265326_10001114 3300028558 Bacteria 9561
103 Ga0265319_1000147 3300028563 Bacteria 52278
104 Ga0265318_10002562 3300028577 Bacteria 9635
105 Ga0265336_10000004 3300028666 Bacteria 418303
106 Ga0265338_10000012 3300028800 Bacteria 418599
107 Ga0265338_10013518 3300028800 Bacteria 9205
108 Ga0265340_10000001 3300031247 Bacteria 1647668
109 Ga0265339_10053397 3300031249 Bacteria 2198
110 Ga0265327_10016817 3300031251 Bacteria 4624
111 Ga0265327_10041484 3300031251 Bacteria 2480
112 Ga0316576_10004293 3300031727 Bacteria 8526
113 Ga0307410_10246249 3300031852 Bacteria 1388
114 Ga0307406_10343525 3300031901 Bacteria 1163
115 Ga0307409_100263548 3300031995 Bacteria 1583
116 Ga0307416_100538464 3300032002 Bacteria 1239
117 Ga0373926_0001360 3300035083 Bacteria 7397
118 Ga0373934_0009542 3300035086 Bacteria 3637
119 Ga0373943_0023645 3300035170 Bacteria 2858
120 Ga0316574_0021019 3300035398 Bacteria 3869
121 Ga0373927_0003222 3300035695 Bacteria 11751
122 Ga0373947_0007612 3300035725 Bacteria 6267
123 Ga0373937_0412457 3300036401 Bacteria 1282
124 Ga0316584_0015106 3300036712 Bacteria 5517
125 Ga0373925_0057941 3300037068 Bacteria 2903
126 Ga0395901_0881722 3300038443 Bacteria 878
127 Ga0436365_0479199 3300039437 Bacteria 5773
128 Ga0466963_0003224 3300044694 Bacteria 9289
129 Ga0466963_0144154 3300044694 Bacteria 1652
130 Ga0466960_0179084 3300044901 Bacteria 1148
131 Ga0466967_0083940 3300045976 Bacteria 2881
132 Ga0466967_0145764 3300045976 Bacteria 2209
133 Ga0495629_0003258 3300046459 Bacteria 12287
134 Ga0495653_0004163 3300046463 Bacteria 11703
135 Ga0495664_0000011 3300046477 Bacteria 253351
136 Ga0495618_0000149 3300046514 Bacteria 49623
137 Ga0495630_0000182 3300046517 Bacteria 48697
138 Ga0495630_0007552 3300046517 Bacteria 7771
139 Ga0495644_0001780 3300046523 Bacteria 8694
140 Ga0495652_0114607 3300046529 Bacteria 2162
141 Ga0495640_0014082 3300046533 Bacteria 6063
142 Ga0495645_0000023 3300046543 Bacteria 130982
143 Ga0495645_0000181 3300046543 Bacteria 44474
144 Ga0495635_0000005 3300046663 Bacteria 302178
145 Ga0495657_0000213 3300046675 Bacteria 52360
146 Ga0495604_0006178 3300047317 Bacteria 9507
147 Ga0495685_027261 3300047447 Bacteria 1965
148 Ga0495684_0014838 3300047471 Bacteria 6000
149 Ga0495684_0092076 3300047471 Bacteria 2296
150 Ga0496100_0005662 3300048903 Bacteria 6755
151 Ga0496100_0150240 3300048903 Bacteria 1660
152 Ga0496101_0006873 3300048904 Bacteria 7345
153 Ga0496101_0125017 3300048904 Bacteria 1948
154 Ga0496102_0000053 3300048905 Bacteria 176385
155 Ga0496103_0000411 3300048906 Bacteria 37997
156 Ga0496104_0000036 3300048907 Bacteria 180472
157 Ga0496105_0036279 3300048908 Bacteria 4061
158 Ga0496106_0093607 3300048909 Bacteria 2322
159 Ga0496107_0013619 3300048910 Bacteria 5685
160 Ga0496108_0336055 3300048911 Bacteria 1317
161 Ga0496109_0131897 3300048912 Bacteria 2332
162 Ga0496110_0000378 3300048913 Bacteria 29857
163 Ga0496110_0190226 3300048913 Bacteria 1864
164 Ga0496111_0152475 3300048914 Bacteria 1714
165 Ga0496115_0000006 3300048918 Bacteria 252944
166 Ga0496115_0000178 3300048918 Bacteria 59512
167 Ga0496115_0047359 3300048918 Bacteria 3438
168 Ga0496115_0366365 3300048918 Bacteria 1173
169 Ga0496121_0005933 3300048924 Bacteria 15450
170 Ga0501036_0056494 3300049572 Bacteria 3326
171 Ga0501036_0218389 3300049572 Bacteria 1601
172 Ga0501039_0004862 3300049575 Bacteria 10168
173 Ga0501039_0294273 3300049575 Bacteria 1276
174 Ga0501043_0234138 3300049579 Bacteria 1418
175 Ga0501076_0092738 3300049592 Bacteria 2430
176 Ga0501077_0121340 3300049593 Bacteria 1657
177 nmdc:mga00v17_78502_c1 3300050491 Bacteria 2057
178 nmdc:mga0yw44_118038_c1 3300050492 Bacteria 1706
179 nmdc:mga0yw44_21765_c1 3300050492 Bacteria 3583
180 nmdc:mga0yw44_48654_c1 3300050492 Bacteria 2557
181 nmdc:mga05p37_668958_c1 3300050507 Bacteria 1159
182 nmdc:mga09592_2260_c1 3300050508 Bacteria 15506
183 nmdc:mga0qj67_11573_c1 3300050509 Bacteria 6617
184 Ga0495601_0002652 3300053077 Bacteria 10148
185 Ga0495601_0012222 3300053077 Bacteria 5148
186 Ga0495612_0000057 3300053078 Bacteria 49938
187 Ga0495655_0032159 3300053083 Bacteria 1282
188 Ga0501082_0234815 3300060353 Bacteria 1596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0881722 Ga0395901_0881722_22_867 280
2 3300025936 Ga0207670_10329409 Ga0207670_103294091 288
3 3300014745 Ga0157377_10168876 Ga0157377_101688762 290
4 3300049593 Ga0501077_0121340 Ga0501077_0121340_688_1569 291
5 3300048904 Ga0496101_0006873 Ga0496101_0006873_3224_4222 305
6 3300048910 Ga0496107_0013619 Ga0496107_0013619_3087_4085 305
7 3300048918 Ga0496115_0047359 Ga0496115_0047359_69_1067 309
8 3300046529 Ga0495652_0114607 Ga0495652_0114607_211_1155 310
9 3300009545 Ga0105237_10000228 Ga0105237_100002289 314
10 3300025914 Ga0207671_10000406 Ga0207671_1000040636 314
11 3300005937 Ga0081455_10114319 Ga0081455_101143192 320
12 3300026088 Ga0207641_10135440 Ga0207641_101354403 323
13 3300045976 Ga0466967_0145764 Ga0466967_0145764_576_1559 323
14 3300036712 Ga0316584_0015106 Ga0316584_0015106_2275_3261 324
15 3300005937 Ga0081455_10021642 Ga0081455_100216423 325
16 3300005983 Ga0081540_1004278 Ga0081540_10042784 325
17 3300005985 Ga0081539_10004153 Ga0081539_1000415317 325
18 3300032002 Ga0307416_100538464 Ga0307416_1005384642 325
19 iso_pu_bacteria 2510917027 2511176783 325
20 iso_pu_bacteria 2512564013 2512636540 325
21 iso_pu_bacteria 2857460504 2857463136 325
22 iso_pu_bacteria 2857465823 2857471523 325
23 iso_pu_bacteria 2857591370 2857597284 325
24 iso_pu_bacteria 2915597211 2915597734 325
25 iso_pu_bacteria 2915606848 2915610699 325
26 iso_pu_bacteria 2929183550 2929189237 325
27 3300006173 Ga0070716_100017948 Ga0070716_1000179482 326
28 3300025939 Ga0207665_10039562 Ga0207665_100395622 326
29 3300005340 Ga0070689_100029995 Ga0070689_1000299952 327
30 3300005356 Ga0070674_100163499 Ga0070674_1001634992 327
31 3300005456 Ga0070678_100180380 Ga0070678_1001803802 327
32 3300005577 Ga0068857_100330510 Ga0068857_1003305102 327
33 3300005578 Ga0068854_100035395 Ga0068854_1000353952 327
34 3300005618 Ga0068864_100210883 Ga0068864_1002108832 327
35 3300005718 Ga0068866_10110140 Ga0068866_101101402 327
36 3300005719 Ga0068861_100006859 Ga0068861_1000068598 327
37 3300005842 Ga0068858_100284203 Ga0068858_1002842032 327
38 3300005843 Ga0068860_100272673 Ga0068860_1002726732 327
39 3300005937 Ga0081455_10064984 Ga0081455_100649842 327
40 3300006846 Ga0075430_100002391 Ga0075430_10000239110 327
41 3300006847 Ga0075431_100089987 Ga0075431_1000899873 327
42 3300006881 Ga0068865_100140619 Ga0068865_1001406192 327
43 3300009098 Ga0105245_10065335 Ga0105245_100653352 327
44 3300009147 Ga0114129_10130566 Ga0114129_101305664 327
45 3300009551 Ga0105238_10477523 Ga0105238_104775231 327
46 3300010375 Ga0105239_10102145 Ga0105239_101021452 327
47 3300010375 Ga0105239_10163679 Ga0105239_101636792 327
48 3300014326 Ga0157380_10066959 Ga0157380_100669592 327
49 3300014745 Ga0157377_10008285 Ga0157377_100082855 327
50 3300014969 Ga0157376_10399679 Ga0157376_103996792 327
51 3300025899 Ga0207642_10015495 Ga0207642_100154952 327
52 3300025901 Ga0207688_10047411 Ga0207688_100474112 327
53 3300025915 Ga0207693_10015425 Ga0207693_100154255 327
54 3300025927 Ga0207687_10021537 Ga0207687_100215372 327
55 3300025933 Ga0207706_10238628 Ga0207706_102386282 327
56 3300025940 Ga0207691_10083667 Ga0207691_100836673 327
57 3300025942 Ga0207689_10055192 Ga0207689_100551922 327
58 3300025944 Ga0207661_10396924 Ga0207661_103969241 327
59 3300026035 Ga0207703_10155019 Ga0207703_101550192 327
60 3300026035 Ga0207703_10307412 Ga0207703_103074122 327
61 3300026067 Ga0207678_10327244 Ga0207678_103272442 327
62 3300026075 Ga0207708_10044145 Ga0207708_100441452 327
63 3300026089 Ga0207648_10147271 Ga0207648_101472712 327
64 3300026118 Ga0207675_100021289 Ga0207675_1000212894 327
65 3300026121 Ga0207683_10280681 Ga0207683_102806812 327
66 3300036401 Ga0373937_0412457 Ga0373937_0412457_252_1235 327
67 3300045976 Ga0466967_0083940 Ga0466967_0083940_387_1382 327
68 3300046517 Ga0495630_0000182 Ga0495630_0000182_5876_6883 327
69 3300046675 Ga0495657_0000213 Ga0495657_0000213_9482_10489 327
70 3300047471 Ga0495684_0014838 Ga0495684_0014838_3947_4954 327
71 3300048903 Ga0496100_0150240 Ga0496100_0150240_318_1313 327
72 3300048904 Ga0496101_0125017 Ga0496101_0125017_115_1110 327
73 3300048908 Ga0496105_0036279 Ga0496105_0036279_2743_3738 327
74 3300048909 Ga0496106_0093607 Ga0496106_0093607_273_1268 327
75 3300048911 Ga0496108_0336055 Ga0496108_0336055_293_1288 327
76 3300048912 Ga0496109_0131897 Ga0496109_0131897_505_1500 327
77 3300048918 Ga0496115_0366365 Ga0496115_0366365_16_1011 327
78 3300049572 Ga0501036_0218389 Ga0501036_0218389_29_1018 327
79 3300050492 nmdc:mga0yw44_48654_c1 nmdc:mga0yw44_48654_c1_1206_2231 327
80 3300050507 nmdc:mga05p37_668958_c1 nmdc:mga05p37_668958_c1_64_1047 327
81 3300053083 Ga0495655_0032159 Ga0495655_0032159_213_1232 327
82 3300005441 Ga0070700_100230851 Ga0070700_1002308512 328
83 3300005455 Ga0070663_100096059 Ga0070663_1000960592 328
84 3300025938 Ga0207704_10147557 Ga0207704_101475572 328
85 3300025291 Ga0209675_1025569 Ga0209675_10255692 329
86 3300026078 Ga0207702_10276834 Ga0207702_102768342 329
87 3300039437 Ga0436365_0479199 Ga0436365_0479199_1073_2068 329
88 3300049572 Ga0501036_0056494 Ga0501036_0056494_1416_2408 329
89 3300049575 Ga0501039_0004862 Ga0501039_0004862_546_1538 329
90 3300005329 Ga0070683_100100163 Ga0070683_1001001632 330
91 3300005365 Ga0070688_100025235 Ga0070688_1000252354 330
92 3300005615 Ga0070702_100004093 Ga0070702_1000040934 330
93 3300005618 Ga0068864_100123823 Ga0068864_1001238232 330
94 3300005719 Ga0068861_100104202 Ga0068861_1001042022 330
95 3300006880 Ga0075429_100028037 Ga0075429_1000280372 330
96 3300009148 Ga0105243_10316939 Ga0105243_103169392 330
97 3300025919 Ga0207657_10053694 Ga0207657_100536942 330
98 3300025927 Ga0207687_10016579 Ga0207687_100165792 330
99 3300025934 Ga0207686_10195334 Ga0207686_101953342 330
100 3300025941 Ga0207711_10105674 Ga0207711_101056742 330
101 3300025944 Ga0207661_10166708 Ga0207661_101667082 330
102 3300026035 Ga0207703_10083447 Ga0207703_100834472 330
103 3300026095 Ga0207676_10088185 Ga0207676_100881852 330
104 3300026118 Ga0207675_100098311 Ga0207675_1000983112 330
105 3300026142 Ga0207698_10351701 Ga0207698_103517012 330
106 3300028379 Ga0268266_10173255 Ga0268266_101732552 330
107 3300044694 Ga0466963_0144154 Ga0466963_0144154_38_1066 330
108 3300046477 Ga0495664_0000011 Ga0495664_0000011_87477_88481 330
109 3300048905 Ga0496102_0000053 Ga0496102_0000053_27914_28918 330
110 3300048906 Ga0496103_0000411 Ga0496103_0000411_13462_14466 330
111 3300048907 Ga0496104_0000036 Ga0496104_0000036_45884_46888 330
112 3300048913 Ga0496110_0000378 Ga0496110_0000378_18420_19424 330
113 3300048913 Ga0496110_0190226 Ga0496110_0190226_479_1474 330
114 3300048924 Ga0496121_0005933 Ga0496121_0005933_2467_3462 330
115 3300050508 nmdc:mga09592_2260_c1 nmdc:mga09592_2260_c1_11226_12236 330
116 3300053077 Ga0495601_0012222 Ga0495601_0012222_939_1943 330
117 3300013308 Ga0157375_10294716 Ga0157375_102947162 331
118 3300005981 Ga0081538_10001862 Ga0081538_1000186228 332
119 3300006038 Ga0075365_10000154 Ga0075365_1000015411 332
120 3300006038 Ga0075365_10011324 Ga0075365_100113242 332
121 3300006846 Ga0075430_100036296 Ga0075430_1000362962 332
122 3300035083 Ga0373926_0001360 Ga0373926_0001360_4537_5574 332
123 3300035086 Ga0373934_0009542 Ga0373934_0009542_1677_2714 332
124 3300035170 Ga0373943_0023645 Ga0373943_0023645_585_1622 332
125 3300035695 Ga0373927_0003222 Ga0373927_0003222_10541_11578 332
126 3300035725 Ga0373947_0007612 Ga0373947_0007612_4454_5491 332
127 3300037068 Ga0373925_0057941 Ga0373925_0057941_1340_2377 332
128 3300044901 Ga0466960_0179084 Ga0466960_0179084_89_1090 332
129 3300050492 nmdc:mga0yw44_118038_c1 nmdc:mga0yw44_118038_c1_432_1472 332
130 3300028800 Ga0265338_10013518 Ga0265338_100135186 333
131 3300031251 Ga0265327_10041484 Ga0265327_100414842 333
132 3300046463 Ga0495653_0004163 Ga0495653_0004163_3894_4949 335
133 3300050509 nmdc:mga0qj67_11573_c1 nmdc:mga0qj67_11573_c1_5237_6274 335
134 3300009093 Ga0105240_10049764 Ga0105240_100497642 338
135 3300046543 Ga0495645_0000181 Ga0495645_0000181_10853_11884 338
136 3300047317 Ga0495604_0006178 Ga0495604_0006178_5976_6998 338
137 3300047447 Ga0495685_027261 Ga0495685_027261_613_1629 338
138 3300048914 Ga0496111_0152475 Ga0496111_0152475_632_1651 339
139 3300031727 Ga0316576_10004293 Ga0316576_100042938 340
140 3300031995 Ga0307409_100263548 Ga0307409_1002635482 340
141 3300005439 Ga0070711_100003627 Ga0070711_1000036275 341
142 3300005439 Ga0070711_100017952 Ga0070711_1000179522 341
143 3300005535 Ga0070684_100086443 Ga0070684_1000864431 341
144 3300005564 Ga0070664_100089782 Ga0070664_1000897822 341
145 3300006048 Ga0075363_100019592 Ga0075363_1000195922 341
146 3300006051 Ga0075364_10017023 Ga0075364_100170232 341
147 3300006173 Ga0070716_100118152 Ga0070716_1001181522 341
148 3300025913 Ga0207695_10036759 Ga0207695_100367592 341
149 3300025916 Ga0207663_10162701 Ga0207663_101627012 341
150 3300025945 Ga0207679_10080669 Ga0207679_100806692 341
151 3300028556 Ga0265337_1002022 Ga0265337_10020224 341
152 3300028558 Ga0265326_10001114 Ga0265326_100011142 341
153 3300028563 Ga0265319_1000147 Ga0265319_100014716 341
154 3300028577 Ga0265318_10002562 Ga0265318_100025628 341
155 3300028666 Ga0265336_10000004 Ga0265336_1000000441 341
156 3300028800 Ga0265338_10000012 Ga0265338_10000012388 341
157 3300031247 Ga0265340_10000001 Ga0265340_100000011241 341
158 3300031249 Ga0265339_10053397 Ga0265339_100533971 341
159 3300031251 Ga0265327_10016817 Ga0265327_100168172 341
160 3300031852 Ga0307410_10246249 Ga0307410_102462491 341
161 3300046514 Ga0495618_0000149 Ga0495618_0000149_7325_8380 341
162 3300046543 Ga0495645_0000023 Ga0495645_0000023_41487_42545 341
163 3300048903 Ga0496100_0005662 Ga0496100_0005662_603_1682 341
164 3300048918 Ga0496115_0000006 Ga0496115_0000006_218255_219334 341
165 3300048918 Ga0496115_0000178 Ga0496115_0000178_6554_7633 341
166 3300049579 Ga0501043_0234138 Ga0501043_0234138_222_1271 341
167 3300053078 Ga0495612_0000057 Ga0495612_0000057_8338_9396 341
168 3300005331 Ga0070670_100177218 Ga0070670_1001772182 342
169 3300005985 Ga0081539_10006125 Ga0081539_100061253 342
170 3300031901 Ga0307406_10343525 Ga0307406_103435251 342
171 3300035398 Ga0316574_0021019 Ga0316574_0021019_2251_3327 342
172 3300046523 Ga0495644_0001780 Ga0495644_0001780_6093_7121 342
173 3300049575 Ga0501039_0294273 Ga0501039_0294273_32_1066 342
174 3300049592 Ga0501076_0092738 Ga0501076_0092738_605_1639 342
175 3300050492 nmdc:mga0yw44_21765_c1 nmdc:mga0yw44_21765_c1_1131_2192 342
176 3300053077 Ga0495601_0002652 Ga0495601_0002652_7904_8977 342
177 3300060353 Ga0501082_0234815 Ga0501082_0234815_69_1103 342
178 3300002239 JGI24034J26672_10000273 JGI24034J26672_100002732 343
179 3300005337 Ga0070682_100000093 Ga0070682_10000009311 343
180 3300005340 Ga0070689_100110043 Ga0070689_1001100432 343
181 3300005353 Ga0070669_100051257 Ga0070669_1000512572 343
182 3300005366 Ga0070659_100005838 Ga0070659_1000058388 343
183 3300005439 Ga0070711_100011904 Ga0070711_1000119044 343
184 3300005535 Ga0070684_100058569 Ga0070684_1000585692 343
185 3300006038 Ga0075365_10046854 Ga0075365_100468541 343
186 3300006051 Ga0075364_10177469 Ga0075364_101774692 343
187 3300006847 Ga0075431_100181810 Ga0075431_1001818102 343
188 3300010375 Ga0105239_10146457 Ga0105239_101464571 343
189 3300013104 Ga0157370_10412665 Ga0157370_104126652 343
190 3300044694 Ga0466963_0003224 Ga0466963_0003224_6117_7148 343
191 3300046459 Ga0495629_0003258 Ga0495629_0003258_2732_3763 343
192 3300046517 Ga0495630_0007552 Ga0495630_0007552_760_1800 343
193 3300046533 Ga0495640_0014082 Ga0495640_0014082_1431_2471 343
194 3300046663 Ga0495635_0000005 Ga0495635_0000005_229100_230131 343
195 3300047471 Ga0495684_0092076 Ga0495684_0092076_160_1191 343
196 3300050491 nmdc:mga00v17_78502_c1 nmdc:mga00v17_78502_c1_927_1967 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

28

163

0.98

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

171

336

0.97

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

180

339

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8afv-assembly1.cif.gz_A daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.9468 16 343
8afu-assembly2.cif.gz_A-2 daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.9411 15 343
2g17-assembly1.cif.gz_A the structure of n-acetyl-gamma-glutamyl-phosphate reductase from salmonella typhimurium. 0.9404 15 343
3dr3-assembly1.cif.gz_A structure of idp00107, a potential n-acetyl-gamma-glutamylphosphate reductase from shigella flexneri 0.938 15 343
1xyg-assembly1.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at2g19940 0.9373 15 343
ID Description Score Start End Superfamily
af_P11446_1_104_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9495 15 110 3.40.50.720
af_I1KL32_193_359_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9405 157 317 3.30.360.10
af_Q2G1H4_146_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9382 158 317 3.30.360.10
af_Q58496_153_306_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9367 164 313 3.30.360.10
af_Q2G1H4_169_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9261 179 317 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A838CZF6-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9868 15 85 GO:0016620
GO:0051287
AF-A0A2W6C510-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.978 15 306 GO:0003942
GO:0006526
GO:0051287
GO:0070401
AF-A0A537VZK3-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9726 18 211 GO:0003942
GO:0006526
GO:0051287
AF-A0A6J7IFM8-F1-model_v4 Unannotated protein 0.9725 11 343 GO:0003942
GO:0006526
GO:0051287
GO:0070401
AF-A0A7Y3GXX3-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9723 66 339 GO:0003942
GO:0005737
GO:0006526
GO:0051287
GO:0070401

Feature Viewer

pLDDT pTM Quality
94.1 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map