F300701

General Info

Members Datasets Scaffolds Average Seq Length
195 157 390 510

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0084086|Ga0501067_0084086_101_1726
Length 541
Sequence MRTASKLAKAAGAXXXALAVVAARDVTQRHHAILRTYPIVGHLRFFLERFGPELRQYIVTNNDEERPFSRDQRRWIYASSKLENSYFGFGTDNDVEHANGYPIIKHRTFKGEGAPTARHAGDEVALPSAKVLGGPRGRRLAFRPTSVVNISGMSFGSLSKNAIEALNRGAAMAGCMHDTGEGALSPYHRKGGDLVFQIGTAYFGCRDEDGRFDLARLKDLCAGAPVRAIEIKLSQGAKPGLGGMLPGAKVTEEIAEIRGIKPGVDCASPSRHTAFHDVDSMLDFVELLADETGLPVGIKSAVGSMGFWDDLVREMGSRQRGVDFVNVDGGEGGTGAAPLLFSDAVSFPFRVGFALVYAKFAAAGLTDDVTFMGAGKLGVPENAVVAFALGVDMVNVGREAMMSIGCIQAQKCHTDHCPTGVATQNPWLVRGLDPELKSVRAANYIKSMRRDLWKISEAMGVVHPGLITPDDIDILDGLSEHRTLRDVYKYDATWGRLGPELQREVIALMATEERPEHSPTRTDTNFATAADSHESGRRPTM

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
40 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
65 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
78 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
79 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
97 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
121 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
122 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
125 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
128 2506783011 Frankia datiscae Dg1 Isolate Nodule
129 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
130 2643221561 Nocardioides sp. Root151 Isolate Unclassified
131 2643221576 Nocardioides sp. Root614 Isolate Unclassified
132 2643221578 Streptomyces sp. Root63 Isolate Unclassified
133 2643221590 Nocardioides sp. Root682 Isolate Unclassified
134 2643221604 Nocardioides sp. Root190 Isolate Unclassified
135 2643221617 Nocardioides sp. Root79 Isolate Unclassified
136 2643221620 Nocardioides sp. Root240 Isolate Unclassified
137 2643221641 Nocardioides sp. Root122 Isolate Unclassified
138 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
139 2643221696 Nocardioides sp. Root140 Isolate Unclassified
140 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
141 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
142 2738541305 Nocardioides sp. CF167 Isolate Unclassified
143 2739367898 Nocardioides sp. CF479 Isolate Unclassified
144 2773857933 Frankia sp. BMG5.30 Isolate Nodule
145 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
146 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
147 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
148 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
149 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
150 2867369537 Streptomyces sp. Z26 Isolate Unclassified
151 2867475112 Streptomyces sp. TM32 Isolate Unclassified
152 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
153 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
154 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
155 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
156 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
157 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.62
Metatranscriptomes 0
Isolates 15.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.85
Nodule 1.54
Rhizoplane 1.54
Rhizosphere 68.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0084086 3300049583 Bacteria 1765
2 JGI24740J21852_10010814 3300001979 Bacteria 3493
3 JGI24735J21928_10005186 3300002067 Bacteria 4337
4 JGI25160J50197_1000426 3300003354 Bacteria 26536
5 Ga0070658_10102656 3300005327 Bacteria 2365
6 Ga0070683_100182598 3300005329 Bacteria 1991
7 Ga0070670_100003127 3300005331 Bacteria 13706
8 Ga0068869_100013947 3300005334 Bacteria 5359
9 Ga0068869_100078667 3300005334 Bacteria 2456
10 Ga0070668_100089637 3300005347 Bacteria 2423
11 Ga0070669_100035022 3300005353 Bacteria 3636
12 Ga0070675_100009482 3300005354 Bacteria 7576
13 Ga0070671_100001274 3300005355 Bacteria 18899
14 Ga0070671_100019299 3300005355 Bacteria 5546
15 Ga0070673_100038667 3300005364 Bacteria 3645
16 Ga0070701_10010890 3300005438 Bacteria 4040
17 Ga0070681_10031548 3300005458 Bacteria 5320
18 Ga0070679_100006703 3300005530 Bacteria 10740
19 Ga0070684_100011180 3300005535 Bacteria 7145
20 Ga0070672_100022589 3300005543 Bacteria 4624
21 Ga0070686_100111253 3300005544 Bacteria 1866
22 Ga0070665_100004100 3300005548 Bacteria 15326
23 Ga0068857_100060058 3300005577 Bacteria 3378
24 Ga0068864_100079729 3300005618 Bacteria 2867
25 Ga0068866_10017603 3300005718 Bacteria 3217
26 Ga0068870_10056902 3300005840 Bacteria 2089
27 Ga0068858_100016721 3300005842 Bacteria 6889
28 Ga0068858_100022733 3300005842 Bacteria 5846
29 Ga0068858_100069498 3300005842 Bacteria 3264
30 Ga0068860_100000237 3300005843 Bacteria 84631
31 Ga0075365_10000474 3300006038 Bacteria 15141
32 Ga0075365_10059557 3300006038 Bacteria 2545
33 Ga0075365_10078813 3300006038 Bacteria 2228
34 Ga0075368_10003471 3300006042 Bacteria 5270
35 Ga0075368_10041579 3300006042 Bacteria 1806
36 Ga0075363_100029607 3300006048 Bacteria 2828
37 Ga0075363_100039326 3300006048 Bacteria 2489
38 Ga0075364_10002163 3300006051 Bacteria 11014
39 Ga0075364_10023009 3300006051 Bacteria 3942
40 Ga0075367_10095065 3300006178 Bacteria 1817
41 Ga0075370_10002477 3300006353 Bacteria 8561
42 Ga0075370_10028877 3300006353 Bacteria 3086
43 Ga0075430_100030548 3300006846 Bacteria 4576
44 Ga0068865_100070339 3300006881 Bacteria 2479
45 Ga0111539_10299529 3300009094 Bacteria 1872
46 Ga0105242_10030275 3300009176 Bacteria 4321
47 Ga0157375_10041971 3300013308 Bacteria 4423
48 Ga0213875_10008159 3300021388 Bacteria 5376
49 Ga0207426_1000495 3300025302 Bacteria 58715
50 Ga0207426_1000563 3300025302 Bacteria 50591
51 Ga0207426_1001335 3300025302 Bacteria 20950
52 Ga0207682_10007513 3300025893 Bacteria 4336
53 Ga0207647_10013738 3300025904 Bacteria 5607
54 Ga0207645_10003629 3300025907 Bacteria 11668
55 Ga0207643_10053896 3300025908 Bacteria 2285
56 Ga0207705_10025017 3300025909 Bacteria 4262
57 Ga0207652_10024578 3300025921 Bacteria 4999
58 Ga0207646_10095641 3300025922 Bacteria 2661
59 Ga0207681_10094314 3300025923 Bacteria 2144
60 Ga0207650_10006734 3300025925 Bacteria 7833
61 Ga0207659_10007577 3300025926 Bacteria 6687
62 Ga0207644_10014268 3300025931 Bacteria 5314
63 Ga0207686_10016199 3300025934 Bacteria 4179
64 Ga0207704_10037010 3300025938 Bacteria 2814
65 Ga0207691_10011416 3300025940 Bacteria 8523
66 Ga0207689_10001325 3300025942 Bacteria 23871
67 Ga0207689_10055616 3300025942 Bacteria 3257
68 Ga0207661_10141029 3300025944 Bacteria 2074
69 Ga0207703_10014693 3300026035 Bacteria 6110
70 Ga0207703_10023672 3300026035 Bacteria 4830
71 Ga0207708_10073827 3300026075 Bacteria 2615
72 Ga0207674_10059877 3300026116 Bacteria 3852
73 Ga0207683_10065590 3300026121 Bacteria 3201
74 Ga0268266_10007996 3300028379 Bacteria 9454
75 Ga0268265_10086998 3300028380 Bacteria 2485
76 Ga0268264_10000195 3300028381 Bacteria 123899
77 Ga0307513_10058939 3300031456 Bacteria 4077
78 Ga0316576_10034318 3300031727 Bacteria 3616
79 Ga0316578_10069438 3300031728 Bacteria 2084
80 Ga0307406_10041172 3300031901 Bacteria 2877
81 Ga0373932_0000089 3300035112 Bacteria 24087
82 Ga0373932_0002233 3300035112 Bacteria 4971
83 Ga0316574_0074327 3300035398 Bacteria 2150
84 Ga0373931_0000006 3300035691 Bacteria 437006
85 Ga0373931_0000014 3300035691 Bacteria 251374
86 Ga0316582_0093942 3300036647 Bacteria 1978
87 Ga0316584_0002929 3300036712 Bacteria 10964
88 Ga0316584_0166180 3300036712 Bacteria 1638
89 Ga0395900_0181125 3300037418 Bacteria 2141
90 Ga0395898_0056561 3300037466 Bacteria 3823
91 Ga0395905_0046140 3300037471 Bacteria 4086
92 Ga0436364_0234888 3300037853 Bacteria 12926
93 Ga0395901_0011716 3300038443 Bacteria 8887
94 Ga0395901_0026891 3300038443 Bacteria 5907
95 Ga0395901_0083741 3300038443 Bacteria 3334
96 Ga0400483_027049 3300039062 Bacteria 24974
97 Ga0400483_031204 3300039062 Bacteria 3935
98 Ga0400483_076700 3300039062 Bacteria 10054
99 Ga0400483_191252 3300039062 Bacteria 6148
100 Ga0439465_0019343 3300041413 Bacteria 2129
101 Ga0451843_1745999 3300041509 Bacteria 2086
102 Ga0466969_0001007 3300044656 Bacteria 15244
103 Ga0466966_0001475 3300044684 Bacteria 15132
104 Ga0466966_0041722 3300044684 Bacteria 2948
105 Ga0466961_0014364 3300044693 Bacteria 5082
106 Ga0466964_0008627 3300044706 Bacteria 3832
107 Ga0466970_0004223 3300044765 Bacteria 7068
108 Ga0466960_0032114 3300044901 Bacteria 2428
109 Ga0466959_0002123 3300045049 Bacteria 12545
110 Ga0466958_0079056 3300045836 Bacteria 2022
111 Ga0495653_0015760 3300046463 Bacteria 6161
112 Ga0495618_0024219 3300046514 Bacteria 3757
113 Ga0495628_0049484 3300046516 Bacteria 3328
114 Ga0495630_0076172 3300046517 Bacteria 2527
115 Ga0495645_0003210 3300046543 Bacteria 11088
116 Ga0495613_0002004 3300046689 Bacteria 15462
117 Ga0495581_0054886 3300047315 Bacteria 2300
118 Ga0495676_0088534 3300047321 Bacteria 2321
119 Ga0495675_0003884 3300047444 Bacteria 9060
120 Ga0495614_0003476 3300048089 Bacteria 7051
121 Ga0496106_0052871 3300048909 Bacteria 3066
122 Ga0496108_0120664 3300048911 Bacteria 2248
123 Ga0496110_0095095 3300048913 Bacteria 2668
124 Ga0496118_0001073 3300048921 Bacteria 42720
125 Ga0501031_0074995 3300049568 Bacteria 2202
126 Ga0501033_0004828 3300049570 Bacteria 10757
127 Ga0501033_0107585 3300049570 Bacteria 2031
128 Ga0501034_0000282 3300049571 Bacteria 91445
129 Ga0501034_0127772 3300049571 Bacteria 2526
130 Ga0501036_0029055 3300049572 Bacteria 4673
131 Ga0501036_0093855 3300049572 Bacteria 2536
132 Ga0501039_0024765 3300049575 Bacteria 4610
133 Ga0501039_0067189 3300049575 Bacteria 2784
134 Ga0501040_0094553 3300049576 Bacteria 2080
135 Ga0501040_0114713 3300049576 Bacteria 1886
136 Ga0501040_0118661 3300049576 Bacteria 1855
137 Ga0501041_0047842 3300049577 Bacteria 2604
138 Ga0501041_0069851 3300049577 Bacteria 2155
139 Ga0501047_0045587 3300049581 Bacteria 4240
140 Ga0501048_0002187 3300049582 Bacteria 14879
141 Ga0501068_0023168 3300049584 Bacteria 3637
142 Ga0501068_0047441 3300049584 Bacteria 2591
143 Ga0501069_0006994 3300049585 Bacteria 5904
144 Ga0501069_0034944 3300049585 Bacteria 2768
145 Ga0501070_0067506 3300049586 Bacteria 2962
146 Ga0501072_0141146 3300049588 Bacteria 1921
147 Ga0501074_0021301 3300049590 Bacteria 4708
148 Ga0501076_0008431 3300049592 Bacteria 7554
149 Ga0501044_0000932 3300049823 Bacteria 35145
150 Ga0501044_0029014 3300049823 Bacteria 5836
151 Ga0501045_0006375 3300049824 Bacteria 8168
152 nmdc:mga00v17_67854_c1 3300050491 Bacteria 2204
153 nmdc:mga0yw44_11381_c2 3300050492 Bacteria 1742
154 nmdc:mga0yw44_38830_c1 3300050492 Bacteria 2819
155 nmdc:mga0yw44_4195_c1 3300050492 Bacteria 6558
156 nmdc:mga0yw44_49439_c1 3300050492 Bacteria 2538
157 nmdc:mga06z11_23329_c1 3300050494 Bacteria 2905
158 nmdc:mga07m45_19262_c1 3300050496 Bacteria 3696
159 nmdc:mga07m45_21861_c1 3300050496 Bacteria 3488
160 nmdc:mga07m45_31202_c1 3300050496 Bacteria 2953
161 nmdc:mga08y16_12883_c1 3300050511 Bacteria 8794
162 Ga0500644_0000278 3300053088 Bacteria 28510
163 Ga0500566_0000154 3300053094 Bacteria 35104
164 Ga0501084_0010189 3300054114 Bacteria 7772
165 Ga0530510_0022653 3300061734 Bacteria 4475
166 2506866506 2506783011 Bacteria 5323186
167 2616901865 2616644941 Bacteria 8510691
168 2643824337 2643221561 Bacteria 4984412
169 2643890415 2643221576 Bacteria 5214352
170 2643899866 2643221578 Bacteria 9213798
171 2643959471 2643221590 Bacteria 5214697
172 2644033073 2643221604 Bacteria 5014917
173 2644099926 2643221617 Bacteria 5139111
174 2644117532 2643221620 Bacteria 5134593
175 2644229837 2643221641 Bacteria 4490190
176 2644409995 2643221673 Bacteria 9196637
177 2644534771 2643221696 Bacteria 5431823
178 2645721370 2643221961 Bacteria 3919167
179 2645724634 2643221962 Bacteria 3874254
180 2738871692 2738541305 Bacteria 4910150
181 2740168138 2739367898 Bacteria 4367674
182 2774904010 2773857933 Bacteria 5818019
183 2812331102 2811994874 Bacteria 5367947
184 2819739706 2818991472 Bacteria 10089953
185 2855390557 2855386786 Bacteria 4752232
186 2862182149 2862178590 Bacteria 8583590
187 2862509624 2862507626 Bacteria 9425308
188 2867370810 2867369537 Bacteria 6501581
189 2867480064 2867475112 Bacteria 6909112
190 2918508935 2918501144 Bacteria 8668083
191 2966598762 2966598605 Bacteria 7676064
192 2995466371 2995463766 Bacteria 8577691
193 8048134549 8048127548 Bacteria 11053136
194 8054613651 8054609563 Bacteria 5170090
195 8056837224 8056829672 Bacteria 9045328
196 Ga0501067_0084086
197 JGI24740J21852_10010814
198 JGI24735J21928_10005186
199 JGI25160J50197_1000426
200 Ga0070658_10102656
201 Ga0070683_100182598
202 Ga0070670_100003127
203 Ga0068869_100013947
204 Ga0068869_100078667
205 Ga0070668_100089637
206 Ga0070669_100035022
207 Ga0070675_100009482
208 Ga0070671_100001274
209 Ga0070671_100019299
210 Ga0070673_100038667
211 Ga0070701_10010890
212 Ga0070681_10031548
213 Ga0070679_100006703
214 Ga0070684_100011180
215 Ga0070672_100022589
216 Ga0070686_100111253
217 Ga0070665_100004100
218 Ga0068857_100060058
219 Ga0068864_100079729
220 Ga0068866_10017603
221 Ga0068870_10056902
222 Ga0068858_100016721
223 Ga0068858_100022733
224 Ga0068858_100069498
225 Ga0068860_100000237
226 Ga0075365_10000474
227 Ga0075365_10059557
228 Ga0075365_10078813
229 Ga0075368_10003471
230 Ga0075368_10041579
231 Ga0075363_100029607
232 Ga0075363_100039326
233 Ga0075364_10002163
234 Ga0075364_10023009
235 Ga0075367_10095065
236 Ga0075370_10002477
237 Ga0075370_10028877
238 Ga0075430_100030548
239 Ga0068865_100070339
240 Ga0111539_10299529
241 Ga0105242_10030275
242 Ga0157375_10041971
243 Ga0213875_10008159
244 Ga0207426_1000495
245 Ga0207426_1000563
246 Ga0207426_1001335
247 Ga0207682_10007513
248 Ga0207647_10013738
249 Ga0207645_10003629
250 Ga0207643_10053896
251 Ga0207705_10025017
252 Ga0207652_10024578
253 Ga0207646_10095641
254 Ga0207681_10094314
255 Ga0207650_10006734
256 Ga0207659_10007577
257 Ga0207644_10014268
258 Ga0207686_10016199
259 Ga0207704_10037010
260 Ga0207691_10011416
261 Ga0207689_10001325
262 Ga0207689_10055616
263 Ga0207661_10141029
264 Ga0207703_10014693
265 Ga0207703_10023672
266 Ga0207708_10073827
267 Ga0207674_10059877
268 Ga0207683_10065590
269 Ga0268266_10007996
270 Ga0268265_10086998
271 Ga0268264_10000195
272 Ga0307513_10058939
273 Ga0316576_10034318
274 Ga0316578_10069438
275 Ga0307406_10041172
276 Ga0373932_0000089
277 Ga0373932_0002233
278 Ga0316574_0074327
279 Ga0373931_0000006
280 Ga0373931_0000014
281 Ga0316582_0093942
282 Ga0316584_0002929
283 Ga0316584_0166180
284 Ga0395900_0181125
285 Ga0395898_0056561
286 Ga0395905_0046140
287 Ga0436364_0234888
288 Ga0395901_0011716
289 Ga0395901_0026891
290 Ga0395901_0083741
291 Ga0400483_027049
292 Ga0400483_031204
293 Ga0400483_076700
294 Ga0400483_191252
295 Ga0439465_0019343
296 Ga0451843_1745999
297 Ga0466969_0001007
298 Ga0466966_0001475
299 Ga0466966_0041722
300 Ga0466961_0014364
301 Ga0466964_0008627
302 Ga0466970_0004223
303 Ga0466960_0032114
304 Ga0466959_0002123
305 Ga0466958_0079056
306 Ga0495653_0015760
307 Ga0495618_0024219
308 Ga0495628_0049484
309 Ga0495630_0076172
310 Ga0495645_0003210
311 Ga0495613_0002004
312 Ga0495581_0054886
313 Ga0495676_0088534
314 Ga0495675_0003884
315 Ga0495614_0003476
316 Ga0496106_0052871
317 Ga0496108_0120664
318 Ga0496110_0095095
319 Ga0496118_0001073
320 Ga0501031_0074995
321 Ga0501033_0004828
322 Ga0501033_0107585
323 Ga0501034_0000282
324 Ga0501034_0127772
325 Ga0501036_0029055
326 Ga0501036_0093855
327 Ga0501039_0024765
328 Ga0501039_0067189
329 Ga0501040_0094553
330 Ga0501040_0114713
331 Ga0501040_0118661
332 Ga0501041_0047842
333 Ga0501041_0069851
334 Ga0501047_0045587
335 Ga0501048_0002187
336 Ga0501068_0023168
337 Ga0501068_0047441
338 Ga0501069_0006994
339 Ga0501069_0034944
340 Ga0501070_0067506
341 Ga0501072_0141146
342 Ga0501074_0021301
343 Ga0501076_0008431
344 Ga0501044_0000932
345 Ga0501044_0029014
346 Ga0501045_0006375
347 nmdc:mga00v17_67854_c1
348 nmdc:mga0yw44_11381_c2
349 nmdc:mga0yw44_38830_c1
350 nmdc:mga0yw44_4195_c1
351 nmdc:mga0yw44_49439_c1
352 nmdc:mga06z11_23329_c1
353 nmdc:mga07m45_19262_c1
354 nmdc:mga07m45_21861_c1
355 nmdc:mga07m45_31202_c1
356 nmdc:mga08y16_12883_c1
357 Ga0500644_0000278
358 Ga0500566_0000154
359 Ga0501084_0010189
360 Ga0530510_0022653
361 2506866506
362 2616901865
363 2643824337
364 2643890415
365 2643899866
366 2643959471
367 2644033073
368 2644099926
369 2644117532
370 2644229837
371 2644409995
372 2644534771
373 2645721370
374 2645724634
375 2738871692
376 2740168138
377 2774904010
378 2812331102
379 2819739706
380 2855390557
381 2862182149
382 2862509624
383 2867370810
384 2867480064
385 2918508935
386 2966598762
387 2995466371
388 8048134549
389 8054613651
390 8056837224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01645

Glu_synthase

Conserved region in glutamate synthase

139

462

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mfm-assembly1.cif.gz_G glutamate synthase, glutamate dehydrogenase counter-enzyme complex 0.8061 61 485
3sr7-assembly1.cif.gz_B crystal structure of s. mutans isopentenyl pyrophosphate isomerase 0.7249 93 470
8g8f-assembly1.cif.gz_F human impdh2 mutant - l245p, treated with atp, imp, and nad+; extended filament segment reconstruction 0.7204 184 386
3tsb-assembly1.cif.gz_A crystal structure of inosine-5'-monophosphate dehydrogenase from bacillus anthracis str. ames 0.7189 181 396
3sr7-assembly1.cif.gz_A crystal structure of s. mutans isopentenyl pyrophosphate isomerase 0.7121 93 470
ID Description Score Start End Superfamily
af_Q2FVF4_136_524_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8995 96 479 3.20.20.70
af_Q58746_138_506_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8961 135 482 3.20.20.70
af_Q2FVF4_136_524_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8707 96 479 3.20.20.70
af_Q58746_138_506_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8104 135 482 3.20.20.70
1ea0A03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7855 52 463 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A437NVF7-F1-model_v4 FMN-binding glutamate synthase family protein 0.982 248 502 GO:0006537
GO:0015930
AF-A0A6J7VEK4-F1-model_v4 Unannotated protein 0.9818 348 501 GO:0006537
GO:0015930
AF-A0A437NVF7-F1-model_v4 FMN-binding glutamate synthase family protein 0.9782 248 502 GO:0006537
GO:0015930
AF-A0A7K1CZV3-F1-model_v4 FMN-binding glutamate synthase family protein 0.9774 312 499 GO:0006537
GO:0015930
AF-A0A327TKK7-F1-model_v4 Glutamate synthase domain-containing protein 2 0.9773 2 500 GO:0006537
GO:0015930

Map