F300693

General Info

Members Datasets Scaffolds Average Seq Length
195 152 194 137

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0603420|Ga0501042_0603420_73_522
Length 149
Sequence VTGAAGGEEGARPRYLADRSALARLGRPEVGAVLEPLILAGEVATCGVVDLEVLYSARSHPDLVRTRATRALAFPLVPMAQADFDRAADVLEALARRGQHRAVGLPDLLIAAVAERTGLTVLHYDADYDLVAAVTGQPTRWVVPRGAVP

Samples

Sample ID Description Type Environment
1 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
73 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
74 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
75 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
76 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
82 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
149 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 7.69
Rhizosphere 87.18
Stem 0
Stem Tuber 0
Unclassified 4.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000604 3300001977 Bacteria 5453
2 JGI24748J21848_1000576 3300002074 Bacteria 3951
3 JGI24034J26672_10000425 3300002239 Bacteria 5469
4 rootL2_10147461 3300003322 Unclassified 1637
5 rootH1_10334211 3300003323 Bacteria 4679
6 Ga0070658_10054211 3300005327 Bacteria 3256
7 Ga0070676_10042081 3300005328 Bacteria 2651
8 Ga0070683_100165872 3300005329 Bacteria 2095
9 Ga0070683_100208833 3300005329 Bacteria 1854
10 Ga0070670_100445590 3300005331 Bacteria 1147
11 Ga0070666_10021109 3300005335 Bacteria 4218
12 Ga0070682_100000150 3300005337 Bacteria 55238
13 Ga0070691_10149548 3300005341 Bacteria 1196
14 Ga0070668_100116822 3300005347 Bacteria 2128
15 Ga0070675_100000015 3300005354 Bacteria 201080
16 Ga0070667_100018995 3300005367 Bacteria 5698
17 Ga0070703_10046362 3300005406 Unclassified 1373
18 Ga0070714_100000170 3300005435 Bacteria 52761
19 Ga0070714_100276361 3300005435 Bacteria 1559
20 Ga0070711_100008321 3300005439 Bacteria 6351
21 Ga0070663_100166387 3300005455 Bacteria 1701
22 Ga0070681_10121493 3300005458 Bacteria 2546
23 Ga0070679_101253269 3300005530 Bacteria 687
24 Ga0070686_100092676 3300005544 Unclassified 2024
25 Ga0070696_100520319 3300005546 Bacteria 949
26 Ga0068855_102226484 3300005563 Bacteria 550
27 Ga0068854_100000095 3300005578 Bacteria 61892
28 Ga0068856_100008468 3300005614 Bacteria 10010
29 Ga0068856_100786878 3300005614 Bacteria 971
30 Ga0068856_100909006 3300005614 Bacteria 899
31 Ga0070702_100116572 3300005615 Unclassified 1665
32 Ga0068866_10003200 3300005718 Bacteria 6745
33 Ga0068863_101581931 3300005841 Bacteria 664
34 Ga0068863_101988132 3300005841 Bacteria 591
35 Ga0068860_100003265 3300005843 Bacteria 16698
36 Ga0081455_10008468 3300005937 Bacteria 10693
37 Ga0075428_100009794 3300006844 Bacteria 10650
38 Ga0075430_100020751 3300006846 Bacteria 5587
39 Ga0075431_100037254 3300006847 Bacteria 5012
40 Ga0075433_10000370 3300006852 Bacteria 28281
41 Ga0075433_10001128 3300006852 Bacteria 19339
42 Ga0075434_100019268 3300006871 Bacteria 6601
43 Ga0075434_100040980 3300006871 Bacteria 4586
44 Ga0075434_100351136 3300006871 Bacteria 1496
45 Ga0075429_100021533 3300006880 Bacteria 5587
46 Ga0075436_100007603 3300006914 Bacteria 7404
47 Ga0105245_10043547 3300009098 Bacteria 4004
48 Ga0105245_11032158 3300009098 Unclassified 867
49 Ga0114129_10000905 3300009147 Bacteria 38592
50 Ga0114129_11038463 3300009147 Unclassified 1030
51 Ga0105241_12402786 3300009174 Bacteria 526
52 Ga0105242_10058150 3300009176 Unclassified 3168
53 Ga0105242_11555137 3300009176 Bacteria 694
54 Ga0105239_10613452 3300010375 Bacteria 1241
55 Ga0105239_10615107 3300010375 Bacteria 1240
56 Ga0105246_10103991 3300011119 Bacteria 2073
57 Ga0157371_10004749 3300013102 Bacteria 11723
58 Ga0157369_10000020 3300013105 Bacteria 241679
59 Ga0157378_10030370 3300013297 Bacteria 4776
60 Ga0157372_10000112 3300013307 Bacteria 85902
61 Ga0157375_10013267 3300013308 Bacteria 7327
62 Ga0157375_13551207 3300013308 Bacteria 519
63 Ga0157380_10001885 3300014326 Bacteria 13907
64 Ga0213875_10005017 3300021388 Bacteria 7175
65 Ga0207653_10075439 3300025885 Unclassified 1159
66 Ga0207642_10002326 3300025899 Bacteria 5929
67 Ga0207680_10665938 3300025903 Unclassified 745
68 Ga0207645_10051047 3300025907 Bacteria 2642
69 Ga0207705_10070832 3300025909 Bacteria 2527
70 Ga0207707_10029496 3300025912 Bacteria 4797
71 Ga0207707_10312142 3300025912 Bacteria 1358
72 Ga0207663_10000690 3300025916 Bacteria 14977
73 Ga0207663_10661554 3300025916 Bacteria 825
74 Ga0207650_10378621 3300025925 Bacteria 1168
75 Ga0207659_10000032 3300025926 Bacteria 119492
76 Ga0207687_10008091 3300025927 Bacteria 6881
77 Ga0207664_10000035 3300025929 Bacteria 173780
78 Ga0207686_10017255 3300025934 Bacteria 4066
79 Ga0207661_10017781 3300025944 Bacteria 5269
80 Ga0207661_10244248 3300025944 Bacteria 1594
81 Ga0207668_10165140 3300025972 Bacteria 1730
82 Ga0207640_10000038 3300025981 Bacteria 108630
83 Ga0207658_10107756 3300025986 Unclassified 2196
84 Ga0207658_11142661 3300025986 Bacteria 712
85 Ga0207678_10289831 3300026067 Bacteria 1406
86 Ga0207702_10000158 3300026078 Bacteria 79984
87 Ga0268264_10010045 3300028381 Bacteria 7835
88 Ga0268264_10353708 3300028381 Unclassified 1399
89 Ga0265326_10000004 3300028558 Bacteria 283947
90 Ga0265326_10003521 3300028558 Bacteria 5117
91 Ga0265319_1000421 3300028563 Bacteria 30464
92 Ga0265319_1001220 3300028563 Bacteria 15881
93 Ga0265334_10000019 3300028573 Bacteria 143921
94 Ga0265334_10056087 3300028573 Bacteria 1497
95 Ga0265322_10010278 3300028654 Bacteria 2714
96 Ga0265336_10001891 3300028666 Bacteria 9055
97 Ga0265338_10000532 3300028800 Bacteria 66760
98 Ga0265338_10002111 3300028800 Bacteria 30659
99 Ga0265338_10024697 3300028800 Bacteria 6131
100 Ga0265338_10361613 3300028800 Bacteria 1041
101 Ga0265338_10730885 3300028800 Bacteria 682
102 Ga0265324_10004148 3300029957 Bacteria 6625
103 Ga0265339_10046047 3300031249 Bacteria 2399
104 Ga0265316_10007016 3300031344 Bacteria 10676
105 Ga0307508_10097780 3300031616 Bacteria 2528
106 Ga0316575_10533769 3300031665 Unclassified 511
107 Ga0265342_10066737 3300031712 Bacteria 2107
108 Ga0265342_10073050 3300031712 Bacteria 1996
109 Ga0307416_102400020 3300032002 Unclassified 627
110 Ga0307415_100824302 3300032126 Unclassified 849
111 Ga0373961_0000336 3300035241 Bacteria 20703
112 Ga0373935_0005031 3300035692 Bacteria 7783
113 Ga0316582_0493441 3300036647 Bacteria 844
114 Ga0436364_0596464 3300037853 Bacteria 2221
115 Ga0436364_1417926 3300037853 Bacteria 29317
116 Ga0436360_1211301 3300039438 Bacteria 681
117 Ga0436360_1246374 3300039438 Unclassified 724
118 Ga0436361_0266486 3300039447 Bacteria 957
119 Ga0436362_0498380 3300039453 Unclassified 769
120 Ga0451793_0211769 3300041452 Unclassified 723
121 Ga0453683_1030577 3300044673 Bacteria 547
122 Ga0466965_0565456 3300044683 Unclassified 643
123 Ga0466970_0048591 3300044765 Bacteria 2262
124 Ga0466960_0525774 3300044901 Bacteria 695
125 Ga0466959_0480370 3300045049 Bacteria 841
126 Ga0466958_0305552 3300045836 Bacteria 1021
127 Ga0466967_0000009 3300045976 Bacteria 122610
128 Ga0466967_0310511 3300045976 Bacteria 1519
129 Ga0495592_0205879 3300046454 Bacteria 1325
130 Ga0495603_0000044 3300046455 Bacteria 53548
131 Ga0495641_0012785 3300046461 Bacteria 4664
132 Ga0495584_0030275 3300046491 Bacteria 2742
133 Ga0495606_0000045 3300046507 Bacteria 212105
134 Ga0495608_0021509 3300046511 Bacteria 4426
135 Ga0495608_0641555 3300046511 Bacteria 635
136 Ga0495628_0002265 3300046516 Bacteria 17396
137 Ga0495628_0005644 3300046516 Bacteria 10953
138 Ga0495628_0503450 3300046516 Unclassified 874
139 Ga0495630_0000007 3300046517 Bacteria 376915
140 Ga0495652_0410434 3300046529 Bacteria 957
141 Ga0495586_0001742 3300046535 Bacteria 11874
142 Ga0495587_0053463 3300046536 Bacteria 2381
143 Ga0495645_0001160 3300046543 Bacteria 17927
144 Ga0495635_0009330 3300046663 Bacteria 6856
145 Ga0495635_0132345 3300046663 Bacteria 1700
146 Ga0495657_0772944 3300046675 Bacteria 550
147 Ga0495613_0000087 3300046689 Bacteria 88644
148 Ga0495672_0208141 3300047320 Unclassified 973
149 Ga0495676_0009847 3300047321 Bacteria 8683
150 Ga0495676_0013420 3300047321 Bacteria 7360
151 Ga0495680_0338142 3300047322 Bacteria 1050
152 Ga0495593_0149744 3300047673 Bacteria 1180
153 Ga0495602_0006000 3300048088 Bacteria 12757
154 Ga0495615_0002414 3300048090 Bacteria 2996
155 Ga0496100_0000035 3300048903 Bacteria 97592
156 Ga0496100_1077278 3300048903 Bacteria 633
157 Ga0496101_0000087 3300048904 Bacteria 101601
158 Ga0496106_0000068 3300048909 Bacteria 83053
159 Ga0496107_0000074 3300048910 Bacteria 48045
160 Ga0496110_0017757 3300048913 Bacteria 5952
161 Ga0496111_0034048 3300048914 Bacteria 3636
162 Ga0496113_0035699 3300048916 Bacteria 3637
163 Ga0496113_0236665 3300048916 Unclassified 1457
164 Ga0496113_0332961 3300048916 Bacteria 1217
165 Ga0496113_0377150 3300048916 Bacteria 1138
166 Ga0496113_0410633 3300048916 Bacteria 1087
167 Ga0496114_0018709 3300048917 Bacteria 5605
168 Ga0496114_0643315 3300048917 Bacteria 933
169 Ga0496124_0583694 3300048927 Unclassified 731
170 Ga0501038_1226221 3300049574 Unclassified 544
171 Ga0501040_1053596 3300049576 Unclassified 590
172 Ga0501042_0603420 3300049578 Unclassified 798
173 Ga0501067_0036754 3300049583 Bacteria 2718
174 Ga0501068_0033585 3300049584 Bacteria 3055
175 Ga0501072_0329693 3300049588 Bacteria 1213
176 Ga0501075_0006116 3300049591 Bacteria 8270
177 Ga0501077_0000467 3300049593 Bacteria 24615
178 Ga0501080_0001898 3300049742 Bacteria 17995
179 Ga0501081_0094257 3300049743 Bacteria 2109
180 nmdc:mga05p37_9206_c1 3300050507 Bacteria 11671
181 nmdc:mga09592_27_c1 3300050508 Bacteria 84251
182 nmdc:mga0qj67_24_c1 3300050509 Bacteria 106844
183 nmdc:mga06r32_226_c2 3300050510 Bacteria 42893
184 nmdc:mga0n895_15965_c1 3300050512 Bacteria 6873
185 nmdc:mga0n895_160579_c1 3300050512 Unclassified 2279
186 nmdc:mga08x19_27407_c1 3300050514 Bacteria 3564
187 nmdc:mga0a205_15_c2 3300050515 Bacteria 75060
188 nmdc:mga0a205_758_c1 3300050515 Bacteria 26047
189 Ga0495612_0000514 3300053078 Bacteria 15576
190 Ga0500556_0146517 3300053104 Unclassified 929
191 Ga0500616_0048316 3300053153 Bacteria 2256
192 Ga0501084_1477112 3300054114 Unclassified 569
193 Ga0501082_0001417 3300060353 Bacteria 21079
194 Ga0501082_0569532 3300060353 Bacteria 991

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048916 Ga0496113_0377150 Ga0496113_0377150_25_384 119
2 3300009174 Ga0105241_12402786 Ga0105241_124027861 121
3 3300039453 Ga0436362_0498380 Ga0436362_0498380_12_377 121
4 3300045976 Ga0466967_0000009 Ga0466967_0000009_108886_109302 122
5 3300053078 Ga0495612_0000514 Ga0495612_0000514_11719_12087 122
6 3300028558 Ga0265326_10003521 Ga0265326_100035213 124
7 3300028573 Ga0265334_10056087 Ga0265334_100560872 124
8 3300028654 Ga0265322_10010278 Ga0265322_100102783 124
9 3300031249 Ga0265339_10046047 Ga0265339_100460472 124
10 3300031344 Ga0265316_10007016 Ga0265316_100070169 124
11 3300031712 Ga0265342_10073050 Ga0265342_100730502 124
12 3300009098 Ga0105245_11032158 Ga0105245_110321581 131
13 3300013308 Ga0157375_13551207 Ga0157375_135512071 131
14 3300048903 Ga0496100_1077278 Ga0496100_1077278_182_604 131
15 3300048917 Ga0496114_0643315 Ga0496114_0643315_92_514 131
16 3300006871 Ga0075434_100040980 Ga0075434_1000409805 132
17 3300028381 Ga0268264_10353708 Ga0268264_103537084 133
18 3300028563 Ga0265319_1000421 Ga0265319_10004216 133
19 3300028800 Ga0265338_10002111 Ga0265338_1000211123 133
20 3300031712 Ga0265342_10066737 Ga0265342_100667372 133
21 3300005937 Ga0081455_10008468 Ga0081455_100084687 134
22 3300049574 Ga0501038_1226221 Ga0501038_1226221_75_491 134
23 3300049576 Ga0501040_1053596 Ga0501040_1053596_33_449 134
24 3300049588 Ga0501072_0329693 Ga0501072_0329693_308_724 134
25 3300054114 Ga0501084_1477112 Ga0501084_1477112_92_508 134
26 3300060353 Ga0501082_0569532 Ga0501082_0569532_283_699 134
27 3300003323 rootH1_10334211 rootH1_103342112 135
28 3300005328 Ga0070676_10042081 Ga0070676_100420813 135
29 3300005335 Ga0070666_10021109 Ga0070666_100211091 135
30 3300005341 Ga0070691_10149548 Ga0070691_101495483 135
31 3300005347 Ga0070668_100116822 Ga0070668_1001168223 135
32 3300005367 Ga0070667_100018995 Ga0070667_1000189955 135
33 3300005841 Ga0068863_101581931 Ga0068863_1015819311 135
34 3300005843 Ga0068860_100003265 Ga0068860_1000032654 135
35 3300006871 Ga0075434_100019268 Ga0075434_1000192683 135
36 3300006871 Ga0075434_100351136 Ga0075434_1003511363 135
37 3300006914 Ga0075436_100007603 Ga0075436_1000076037 135
38 3300025903 Ga0207680_10665938 Ga0207680_106659382 135
39 3300025907 Ga0207645_10051047 Ga0207645_100510473 135
40 3300025972 Ga0207668_10165140 Ga0207668_101651403 135
41 3300025986 Ga0207658_10107756 Ga0207658_101077563 135
42 3300025986 Ga0207658_11142661 Ga0207658_111426611 135
43 3300028381 Ga0268264_10010045 Ga0268264_100100458 135
44 3300031616 Ga0307508_10097780 Ga0307508_100977803 135
45 3300031665 Ga0316575_10533769 Ga0316575_105337691 135
46 3300032002 Ga0307416_102400020 Ga0307416_1024000202 135
47 3300035241 Ga0373961_0000336 Ga0373961_0000336_12191_12604 135
48 3300035692 Ga0373935_0005031 Ga0373935_0005031_1015_1437 135
49 3300041452 Ga0451793_0211769 Ga0451793_0211769_196_609 135
50 3300046689 Ga0495613_0000087 Ga0495613_0000087_44864_45274 135
51 3300048090 Ga0495615_0002414 Ga0495615_0002414_1928_2350 135
52 3300049583 Ga0501067_0036754 Ga0501067_0036754_2054_2476 135
53 3300049591 Ga0501075_0006116 Ga0501075_0006116_1307_1729 135
54 3300049593 Ga0501077_0000467 Ga0501077_0000467_1415_1837 135
55 3300049742 Ga0501080_0001898 Ga0501080_0001898_8919_9341 135
56 3300050512 nmdc:mga0n895_15965_c1 nmdc:mga0n895_15965_c1_2058_2471 135
57 3300050512 nmdc:mga0n895_160579_c1 nmdc:mga0n895_160579_c1_1554_1976 135
58 3300050514 nmdc:mga08x19_27407_c1 nmdc:mga08x19_27407_c1_1100_1522 135
59 3300060353 Ga0501082_0001417 Ga0501082_0001417_19415_19837 135
60 iso_pu_bacteria 2902792274 2902793181 135
61 3300005435 Ga0070714_100276361 Ga0070714_1002763612 136
62 3300005458 Ga0070681_10121493 Ga0070681_101214933 136
63 3300005530 Ga0070679_101253269 Ga0070679_1012532691 136
64 3300005614 Ga0068856_100909006 Ga0068856_1009090062 136
65 3300009147 Ga0114129_11038463 Ga0114129_110384632 136
66 3300009176 Ga0105242_11555137 Ga0105242_115551372 136
67 3300025912 Ga0207707_10312142 Ga0207707_103121422 136
68 3300032126 Ga0307415_100824302 Ga0307415_1008243022 136
69 3300037853 Ga0436364_0596464 Ga0436364_0596464_1494_1907 136
70 3300039438 Ga0436360_1211301 Ga0436360_1211301_138_551 136
71 3300039438 Ga0436360_1246374 Ga0436360_1246374_98_511 136
72 3300039447 Ga0436361_0266486 Ga0436361_0266486_448_861 136
73 3300044673 Ga0453683_1030577 Ga0453683_1030577_79_492 136
74 3300044683 Ga0466965_0565456 Ga0466965_0565456_122_532 136
75 3300044765 Ga0466970_0048591 Ga0466970_0048591_1002_1457 136
76 3300045049 Ga0466959_0480370 Ga0466959_0480370_382_795 136
77 3300045836 Ga0466958_0305552 Ga0466958_0305552_184_597 136
78 3300045976 Ga0466967_0310511 Ga0466967_0310511_661_1077 136
79 3300046491 Ga0495584_0030275 Ga0495584_0030275_131_544 136
80 3300046675 Ga0495657_0772944 Ga0495657_0772944_77_490 136
81 3300049584 Ga0501068_0033585 Ga0501068_0033585_1079_1498 136
82 3300053104 Ga0500556_0146517 Ga0500556_0146517_157_579 136
83 3300053153 Ga0500616_0048316 Ga0500616_0048316_994_1416 136
84 3300005718 Ga0068866_10003200 Ga0068866_100032003 137
85 3300006844 Ga0075428_100009794 Ga0075428_1000097949 137
86 3300006846 Ga0075430_100020751 Ga0075430_1000207516 137
87 3300006847 Ga0075431_100037254 Ga0075431_1000372545 137
88 3300006880 Ga0075429_100021533 Ga0075429_1000215334 137
89 3300009147 Ga0114129_10000905 Ga0114129_1000090522 137
90 3300025899 Ga0207642_10002326 Ga0207642_100023264 137
91 3300025916 Ga0207663_10661554 Ga0207663_106615542 137
92 3300028800 Ga0265338_10000532 Ga0265338_1000053233 137
93 3300044901 Ga0466960_0525774 Ga0466960_0525774_165_587 137
94 3300049578 Ga0501042_0603420 Ga0501042_0603420_73_522 137
95 3300050507 nmdc:mga05p37_9206_c1 nmdc:mga05p37_9206_c1_6160_6579 137
96 3300050508 nmdc:mga09592_27_c1 nmdc:mga09592_27_c1_79242_79661 137
97 3300050509 nmdc:mga0qj67_24_c1 nmdc:mga0qj67_24_c1_79236_79655 137
98 3300050510 nmdc:mga06r32_226_c2 nmdc:mga06r32_226_c2_15422_15841 137
99 3300001977 JGI24746J21847_1000604 JGI24746J21847_10006045 138
100 3300002074 JGI24748J21848_1000576 JGI24748J21848_10005766 138
101 3300002239 JGI24034J26672_10000425 JGI24034J26672_100004252 138
102 3300003322 rootL2_10147461 rootL2_101474613 138
103 3300005327 Ga0070658_10054211 Ga0070658_100542113 138
104 3300005329 Ga0070683_100165872 Ga0070683_1001658723 138
105 3300005329 Ga0070683_100208833 Ga0070683_1002088332 138
106 3300005331 Ga0070670_100445590 Ga0070670_1004455903 138
107 3300005337 Ga0070682_100000150 Ga0070682_10000015055 138
108 3300005354 Ga0070675_100000015 Ga0070675_100000015122 138
109 3300005406 Ga0070703_10046362 Ga0070703_100463622 138
110 3300005435 Ga0070714_100000170 Ga0070714_10000017024 138
111 3300005439 Ga0070711_100008321 Ga0070711_1000083217 138
112 3300005455 Ga0070663_100166387 Ga0070663_1001663872 138
113 3300005544 Ga0070686_100092676 Ga0070686_1000926761 138
114 3300005546 Ga0070696_100520319 Ga0070696_1005203192 138
115 3300005563 Ga0068855_102226484 Ga0068855_1022264841 138
116 3300005578 Ga0068854_100000095 Ga0068854_10000009555 138
117 3300005614 Ga0068856_100008468 Ga0068856_1000084686 138
118 3300005614 Ga0068856_100786878 Ga0068856_1007868783 138
119 3300005615 Ga0070702_100116572 Ga0070702_1001165722 138
120 3300005841 Ga0068863_101988132 Ga0068863_1019881321 138
121 3300006852 Ga0075433_10000370 Ga0075433_1000037018 138
122 3300006852 Ga0075433_10001128 Ga0075433_1000112811 138
123 3300009098 Ga0105245_10043547 Ga0105245_100435473 138
124 3300009176 Ga0105242_10058150 Ga0105242_100581504 138
125 3300010375 Ga0105239_10613452 Ga0105239_106134522 138
126 3300010375 Ga0105239_10615107 Ga0105239_106151071 138
127 3300011119 Ga0105246_10103991 Ga0105246_101039914 138
128 3300013102 Ga0157371_10004749 Ga0157371_100047498 138
129 3300013105 Ga0157369_10000020 Ga0157369_10000020194 138
130 3300013297 Ga0157378_10030370 Ga0157378_100303703 138
131 3300013307 Ga0157372_10000112 Ga0157372_1000011254 138
132 3300013308 Ga0157375_10013267 Ga0157375_100132676 138
133 3300014326 Ga0157380_10001885 Ga0157380_100018856 138
134 3300021388 Ga0213875_10005017 Ga0213875_100050178 138
135 3300025885 Ga0207653_10075439 Ga0207653_100754391 138
136 3300025909 Ga0207705_10070832 Ga0207705_100708323 138
137 3300025912 Ga0207707_10029496 Ga0207707_100294966 138
138 3300025916 Ga0207663_10000690 Ga0207663_100006903 138
139 3300025925 Ga0207650_10378621 Ga0207650_103786212 138
140 3300025926 Ga0207659_10000032 Ga0207659_10000032101 138
141 3300025927 Ga0207687_10008091 Ga0207687_100080912 138
142 3300025929 Ga0207664_10000035 Ga0207664_10000035144 138
143 3300025934 Ga0207686_10017255 Ga0207686_100172553 138
144 3300025944 Ga0207661_10017781 Ga0207661_100177818 138
145 3300025944 Ga0207661_10244248 Ga0207661_102442483 138
146 3300025981 Ga0207640_10000038 Ga0207640_1000003858 138
147 3300026067 Ga0207678_10289831 Ga0207678_102898312 138
148 3300026078 Ga0207702_10000158 Ga0207702_1000015882 138
149 3300028558 Ga0265326_10000004 Ga0265326_10000004271 138
150 3300028563 Ga0265319_1001220 Ga0265319_10012204 138
151 3300028573 Ga0265334_10000019 Ga0265334_1000001982 138
152 3300028666 Ga0265336_10001891 Ga0265336_100018918 138
153 3300028800 Ga0265338_10024697 Ga0265338_100246976 138
154 3300028800 Ga0265338_10361613 Ga0265338_103616132 138
155 3300028800 Ga0265338_10730885 Ga0265338_107308851 138
156 3300029957 Ga0265324_10004148 Ga0265324_1000414810 138
157 3300036647 Ga0316582_0493441 Ga0316582_0493441_116_532 138
158 3300037853 Ga0436364_1417926 Ga0436364_1417926_5025_5441 138
159 3300046454 Ga0495592_0205879 Ga0495592_0205879_305_721 138
160 3300046455 Ga0495603_0000044 Ga0495603_0000044_1484_1900 138
161 3300046461 Ga0495641_0012785 Ga0495641_0012785_1215_1631 138
162 3300046507 Ga0495606_0000045 Ga0495606_0000045_81103_81519 138
163 3300046511 Ga0495608_0021509 Ga0495608_0021509_3672_4088 138
164 3300046511 Ga0495608_0641555 Ga0495608_0641555_106_522 138
165 3300046516 Ga0495628_0002265 Ga0495628_0002265_6874_7290 138
166 3300046516 Ga0495628_0005644 Ga0495628_0005644_7028_7444 138
167 3300046516 Ga0495628_0503450 Ga0495628_0503450_266_682 138
168 3300046517 Ga0495630_0000007 Ga0495630_0000007_285123_285539 138
169 3300046529 Ga0495652_0410434 Ga0495652_0410434_43_459 138
170 3300046535 Ga0495586_0001742 Ga0495586_0001742_7512_7928 138
171 3300046536 Ga0495587_0053463 Ga0495587_0053463_1477_1893 138
172 3300046543 Ga0495645_0001160 Ga0495645_0001160_1525_1944 138
173 3300046663 Ga0495635_0009330 Ga0495635_0009330_553_969 138
174 3300046663 Ga0495635_0132345 Ga0495635_0132345_72_488 138
175 3300047320 Ga0495672_0208141 Ga0495672_0208141_465_881 138
176 3300047321 Ga0495676_0009847 Ga0495676_0009847_282_701 138
177 3300047321 Ga0495676_0013420 Ga0495676_0013420_2178_2594 138
178 3300047322 Ga0495680_0338142 Ga0495680_0338142_569_985 138
179 3300047673 Ga0495593_0149744 Ga0495593_0149744_480_896 138
180 3300048088 Ga0495602_0006000 Ga0495602_0006000_4060_4476 138
181 3300048903 Ga0496100_0000035 Ga0496100_0000035_12412_12828 138
182 3300048904 Ga0496101_0000087 Ga0496101_0000087_16456_16872 138
183 3300048909 Ga0496106_0000068 Ga0496106_0000068_66620_67036 138
184 3300048910 Ga0496107_0000074 Ga0496107_0000074_12706_13122 138
185 3300048913 Ga0496110_0017757 Ga0496110_0017757_1910_2326 138
186 3300048914 Ga0496111_0034048 Ga0496111_0034048_681_1097 138
187 3300048916 Ga0496113_0035699 Ga0496113_0035699_653_1084 138
188 3300048916 Ga0496113_0236665 Ga0496113_0236665_749_1168 138
189 3300048916 Ga0496113_0332961 Ga0496113_0332961_419_835 138
190 3300048916 Ga0496113_0410633 Ga0496113_0410633_410_826 138
191 3300048917 Ga0496114_0018709 Ga0496114_0018709_1187_1603 138
192 3300048927 Ga0496124_0583694 Ga0496124_0583694_22_438 138
193 3300049743 Ga0501081_0094257 Ga0501081_0094257_1252_1668 138
194 3300050515 nmdc:mga0a205_15_c2 nmdc:mga0a205_15_c2_59021_59452 138
195 3300050515 nmdc:mga0a205_758_c1 nmdc:mga0a205_758_c1_10913_11329 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

15

134

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5sv2-assembly1.cif.gz_A-2 toxin vapc21 from mycobacterium tuberculosis 0.9434 1 135
5sv2-assembly1.cif.gz_A-2 toxin vapc21 from mycobacterium tuberculosis 0.9367 1 135
3h87-assembly1.cif.gz_B rv0301 rv0300 toxin antitoxin complex from mycobacterium tuberculosis 0.9023 2 134
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.885 2 132
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.8545 2 132
ID Description Score Start End Superfamily
af_P95007_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9575 4 136 3.40.50.1010
5sv2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9433 1 135 3.40.50.1010
af_L0T5V6_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9403 1 136 3.40.50.1010
af_P95007_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.937 4 136 3.40.50.1010
5sv2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9366 1 135 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1Q3PVN6-F1-model_v4 deleted 0.9833 16 136
AF-A0A7W0R3L6-F1-model_v4 Uncharacterized protein 0.9826 2 87
AF-A0A6J6VJS8-F1-model_v4 Unannotated protein 0.979 25 138 GO:0004518
GO:0046872
AF-A0A3A9VZB5-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9783 1 136 GO:0000287
GO:0004540
GO:0090729
AF-A0A7X6L476-F1-model_v4 PIN domain nuclease 0.9775 34 130 GO:0004518
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.3 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map