F300666

General Info

Members Datasets Scaffolds Average Seq Length
195 117 390 145

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0022758|Ga0501031_0022758_3437_3886
Length 149
Sequence MPLRPCVFCEIVAGRRPAHVVLDDEQALAFLDVRPLFPGHTLLVPRAHVETLADLPADELGPYFARAQRLARAMEAPDGMEAAGSFVALNNRVSQSVPHLHTHVVPRNPKDGLRGFFWPRGKYADDAEAAAVAGRLREAVDRLSRLEAH

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
8 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
9 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
27 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
35 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
36 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
37 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
38 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
39 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
40 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
41 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
42 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
43 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
44 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
45 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
46 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
47 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
48 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
49 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
50 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
53 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
54 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
55 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
56 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
57 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
58 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
59 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
60 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
61 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
62 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
63 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
64 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
65 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
66 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
67 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
68 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
69 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
84 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
85 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
86 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
87 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
88 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
89 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
90 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
91 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
92 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
95 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
103 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
109 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
111 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
112 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
113 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
114 2867369537 Streptomyces sp. Z26 Isolate Unclassified
115 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
116 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
117 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.59
Nodule 0
Rhizoplane 3.08
Rhizosphere 87.69
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0022758 3300049568 Bacteria 4085
2 JGI25407J50210_10000541 3300003373 Bacteria 7601
3 Ga0070667_100022387 3300005367 Bacteria 5242
4 Ga0070713_100001032 3300005436 Bacteria 17807
5 Ga0070711_100385365 3300005439 Bacteria 1134
6 Ga0070706_100214749 3300005467 Bacteria 1796
7 Ga0070699_100006362 3300005518 Bacteria 10297
8 Ga0070697_100170065 3300005536 Bacteria 1844
9 Ga0070695_100277935 3300005545 Bacteria 1229
10 Ga0081455_10005920 3300005937 Bacteria 13270
11 Ga0081455_10014899 3300005937 Bacteria 7578
12 Ga0081538_10000759 3300005981 Bacteria 35225
13 Ga0075368_10141634 3300006042 Bacteria 1002
14 Ga0075364_10181021 3300006051 Bacteria 1426
15 Ga0075364_10879706 3300006051 Bacteria 610
16 Ga0070716_100161842 3300006173 Bacteria 1451
17 Ga0075428_100652536 3300006844 Bacteria 1122
18 Ga0075430_100000283 3300006846 Bacteria 35641
19 Ga0075430_100027334 3300006846 Bacteria 4848
20 Ga0075430_100064831 3300006846 Bacteria 3070
21 Ga0075431_100000042 3300006847 Bacteria 65748
22 Ga0075431_100000206 3300006847 Bacteria 43562
23 Ga0075431_100245476 3300006847 Bacteria 1820
24 Ga0075431_100490941 3300006847 Bacteria 1220
25 Ga0075433_10658300 3300006852 Bacteria 918
26 Ga0075434_100749715 3300006871 Bacteria 993
27 Ga0075429_100001297 3300006880 Bacteria 20368
28 Ga0075429_100002569 3300006880 Bacteria 15301
29 Ga0075435_100050665 3300007076 Bacteria 3342
30 Ga0111539_10546917 3300009094 Bacteria 1349
31 Ga0111539_11662132 3300009094 Bacteria 741
32 Ga0105245_10000455 3300009098 Bacteria 37524
33 Ga0114129_10001339 3300009147 Bacteria 33042
34 Ga0114129_10324073 3300009147 Bacteria 2047
35 Ga0114129_10833645 3300009147 Bacteria 1174
36 Ga0114129_12039898 3300009147 Bacteria 693
37 Ga0163162_11502515 3300013306 Bacteria 767
38 Ga0213875_10095068 3300021388 Unclassified 1390
39 Ga0213875_10196008 3300021388 Bacteria 950
40 Ga0207684_10070539 3300025910 Bacteria 2970
41 Ga0207663_10660848 3300025916 Bacteria 825
42 Ga0207687_10001933 3300025927 Bacteria 14248
43 Ga0207700_10002836 3300025928 Bacteria 9970
44 Ga0207665_10200528 3300025939 Bacteria 1454
45 Ga0207689_11266324 3300025942 Bacteria 620
46 Ga0207658_10082402 3300025986 Bacteria 2470
47 Ga0307514_10196205 3300031649 Bacteria 1277
48 Ga0307413_10164344 3300031824 Bacteria 1563
49 Ga0307410_10015943 3300031852 Bacteria 4468
50 Ga0307410_11081282 3300031852 Bacteria 695
51 Ga0307406_11037705 3300031901 Bacteria 705
52 Ga0307412_10366503 3300031911 Bacteria 1162
53 Ga0307409_100048007 3300031995 Bacteria 3246
54 Ga0307415_100012157 3300032126 Bacteria 4968
55 Ga0307415_100446197 3300032126 Bacteria 1117
56 Ga0373923_0503078 3300035111 Unclassified 591
57 Ga0436364_0831806 3300037853 Bacteria 8490
58 Ga0436364_1026533 3300037853 Bacteria 1419
59 Ga0439450_002047 3300042008 Bacteria 3098
60 Ga0439464_0045338 3300042439 Bacteria 1261
61 Ga0439460_0013305 3300042461 Bacteria 2151
62 Ga0451577_0027576 3300042876 Bacteria 5141
63 Ga0439440_0044022 3300042993 Bacteria 1096
64 Ga0466972_0330932 3300044658 Bacteria 712
65 Ga0453683_0789592 3300044673 Bacteria 625
66 Ga0453684_0343073 3300044712 Bacteria 1686
67 Ga0451576_0176508 3300045051 Bacteria 2230
68 Ga0495590_0268112 3300046457 Bacteria 638
69 Ga0495652_0166443 3300046529 Bacteria 1706
70 Ga0495667_0528113 3300046559 Bacteria 738
71 Ga0495623_0626316 3300046679 Bacteria 557
72 Ga0495604_0141308 3300047317 Bacteria 1720
73 Ga0495680_0061519 3300047322 Bacteria 2888
74 Ga0495685_057697 3300047447 Bacteria 1311
75 Ga0495684_0630231 3300047471 Bacteria 720
76 Ga0495602_0213209 3300048088 Bacteria 1464
77 Ga0496101_0004714 3300048904 Bacteria 8637
78 Ga0496102_0029080 3300048905 Bacteria 4941
79 Ga0496105_0062695 3300048908 Bacteria 3068
80 Ga0496107_0285956 3300048910 Bacteria 1227
81 Ga0496114_0429373 3300048917 Bacteria 1170
82 Ga0496115_0012591 3300048918 Bacteria 6371
83 Ga0496121_0192520 3300048924 Bacteria 1461
84 Ga0496124_0445341 3300048927 Bacteria 885
85 Ga0501031_0092537 3300049568 Bacteria 1973
86 Ga0501032_0047069 3300049569 Bacteria 2914
87 Ga0501033_0002967 3300049570 Bacteria 14171
88 Ga0501033_0017528 3300049570 Bacteria 5411
89 Ga0501034_0012247 3300049571 Bacteria 8863
90 Ga0501036_0003775 3300049572 Bacteria 12143
91 Ga0501036_0018904 3300049572 Bacteria 5781
92 Ga0501036_0157042 3300049572 Bacteria 1918
93 Ga0501037_0021451 3300049573 Bacteria 4774
94 Ga0501037_0392199 3300049573 Bacteria 953
95 Ga0501038_0028534 3300049574 Bacteria 4958
96 Ga0501039_0005623 3300049575 Bacteria 9489
97 Ga0501039_0009402 3300049575 Bacteria 7451
98 Ga0501039_0063224 3300049575 Bacteria 2868
99 Ga0501039_0140829 3300049575 Bacteria 1895
100 Ga0501040_0018386 3300049576 Bacteria 4640
101 Ga0501040_0070293 3300049576 Bacteria 2415
102 Ga0501040_0111978 3300049576 Bacteria 1909
103 Ga0501041_0004840 3300049577 Bacteria 7827
104 Ga0501041_0014250 3300049577 Bacteria 4720
105 Ga0501041_0798367 3300049577 Bacteria 605
106 Ga0501042_0008858 3300049578 Bacteria 6671
107 Ga0501042_0067676 3300049578 Bacteria 2553
108 Ga0501042_0326230 3300049578 Bacteria 1109
109 Ga0501043_0106524 3300049579 Unclassified 2202
110 Ga0501046_0021135 3300049580 Bacteria 5374
111 Ga0501046_0041823 3300049580 Bacteria 3655
112 Ga0501046_1216182 3300049580 Bacteria 517
113 Ga0501047_0375643 3300049581 Bacteria 1256
114 Ga0501048_0061485 3300049582 Bacteria 2659
115 Ga0501048_0065529 3300049582 Bacteria 2568
116 Ga0501048_0181109 3300049582 Bacteria 1493
117 Ga0501048_0302493 3300049582 Bacteria 1138
118 Ga0501068_0068489 3300049584 Bacteria 2163
119 Ga0501068_0599915 3300049584 Bacteria 717
120 Ga0501069_0574703 3300049585 Bacteria 675
121 Ga0501070_0711394 3300049586 Bacteria 794
122 Ga0501070_0886032 3300049586 Bacteria 697
123 Ga0501071_0027485 3300049587 Bacteria 4003
124 Ga0501071_0065384 3300049587 Bacteria 2640
125 Ga0501071_0611586 3300049587 Bacteria 838
126 Ga0501072_0002964 3300049588 Bacteria 12789
127 Ga0501072_0387288 3300049588 Bacteria 1109
128 Ga0501072_0771894 3300049588 Bacteria 754
129 Ga0501074_0063456 3300049590 Bacteria 2661
130 Ga0501074_0073677 3300049590 Bacteria 2453
131 Ga0501074_0949757 3300049590 Bacteria 605
132 Ga0501075_0003752 3300049591 Bacteria 10205
133 Ga0501075_0032087 3300049591 Bacteria 3901
134 Ga0501075_0237806 3300049591 Bacteria 1388
135 Ga0501076_0008391 3300049592 Bacteria 7570
136 Ga0501076_0252930 3300049592 Bacteria 1442
137 Ga0501076_0562848 3300049592 Bacteria 940
138 Ga0501077_0000418 3300049593 Bacteria 25732
139 Ga0501077_0143390 3300049593 Bacteria 1515
140 Ga0501077_0264285 3300049593 Bacteria 1094
141 Ga0501079_0004007 3300049741 Bacteria 10892
142 Ga0501079_0010288 3300049741 Bacteria 7106
143 Ga0501079_0024211 3300049741 Bacteria 4659
144 Ga0501080_0259293 3300049742 Bacteria 1584
145 Ga0501080_0311947 3300049742 Bacteria 1425
146 Ga0501080_1030657 3300049742 Bacteria 713
147 Ga0501081_0000854 3300049743 Bacteria 17989
148 Ga0501081_0048585 3300049743 Bacteria 2920
149 Ga0501081_0455034 3300049743 Bacteria 951
150 Ga0501083_0026974 3300049744 Bacteria 3967
151 Ga0501035_0761146 3300049822 Bacteria 776
152 Ga0501044_0052736 3300049823 Bacteria 4188
153 Ga0501044_0262620 3300049823 Bacteria 1665
154 Ga0501044_0766383 3300049823 Bacteria 846
155 Ga0501045_0008544 3300049824 Bacteria 7138
156 Ga0501045_0026312 3300049824 Bacteria 4184
157 nmdc:mga00v17_75189_c1 3300050491 Bacteria 2100
158 nmdc:mga00v17_779328_c1 3300050491 Bacteria 610
159 nmdc:mga04h51_113379_c1 3300050495 Bacteria 1002
160 nmdc:mga05p37_1019563_c1 3300050507 Bacteria 877
161 nmdc:mga05p37_343_c1 3300050507 Bacteria 49990
162 nmdc:mga05p37_41624_c1 3300050507 Bacteria 5641
163 nmdc:mga09592_1351_c1 3300050508 Bacteria 19599
164 nmdc:mga09592_495_c1 3300050508 Bacteria 29606
165 nmdc:mga0qj67_1095_c1 3300050509 Bacteria 18766
166 nmdc:mga0qj67_74020_c1 3300050509 Bacteria 2721
167 nmdc:mga0qj67_7819_c1 3300050509 Bacteria 7904
168 nmdc:mga0qj67_93219_c1 3300050509 Bacteria 2421
169 nmdc:mga06r32_1044_c1 3300050510 Bacteria 24972
170 nmdc:mga06r32_398523_c1 3300050510 Bacteria 1358
171 nmdc:mga06r32_587310_c1 3300050510 Bacteria 1086
172 nmdc:mga06r32_875_c1 3300050510 Bacteria 26824
173 nmdc:mga08y16_1109657_c1 3300050511 Unclassified 766
174 nmdc:mga0n895_697037_c1 3300050512 Bacteria 1012
175 nmdc:mga0a205_12180_c1 3300050515 Bacteria 7952
176 nmdc:mga0a205_850072_c1 3300050515 Bacteria 760
177 Ga0495595_0104210 3300053084 Bacteria 1371
178 Ga0500616_0092906 3300053153 Bacteria 1490
179 Ga0501084_0013389 3300054114 Bacteria 6786
180 Ga0501084_0013824 3300054114 Bacteria 6682
181 Ga0501084_0125776 3300054114 Bacteria 2157
182 Ga0501082_0001475 3300060353 Bacteria 20669
183 Ga0501082_0002106 3300060353 Bacteria 17519
184 Ga0501082_0132198 3300060353 Bacteria 2165
185 Ga0501082_0338514 3300060353 Bacteria 1311
186 Ga0501082_0358607 3300060353 Bacteria 1272
187 Ga0501082_0635822 3300060353 Bacteria 934
188 Ga0530510_0046668 3300061734 Bacteria 3129
189 Ga0530510_0053668 3300061734 Bacteria 2912
190 Ga0530510_0467525 3300061734 Bacteria 954
191 2819746512 2818991472 Bacteria 10089953
192 2867369602 2867369537 Bacteria 6501581
193 2995470025 2995463766 Bacteria 8577691
194 3003006950 3002998708 Bacteria 11715108
195 3006426949 3006425503 Bacteria 6491253
196 Ga0501031_0022758
197 JGI25407J50210_10000541
198 Ga0070667_100022387
199 Ga0070713_100001032
200 Ga0070711_100385365
201 Ga0070706_100214749
202 Ga0070699_100006362
203 Ga0070697_100170065
204 Ga0070695_100277935
205 Ga0081455_10005920
206 Ga0081455_10014899
207 Ga0081538_10000759
208 Ga0075368_10141634
209 Ga0075364_10181021
210 Ga0075364_10879706
211 Ga0070716_100161842
212 Ga0075428_100652536
213 Ga0075430_100000283
214 Ga0075430_100027334
215 Ga0075430_100064831
216 Ga0075431_100000042
217 Ga0075431_100000206
218 Ga0075431_100245476
219 Ga0075431_100490941
220 Ga0075433_10658300
221 Ga0075434_100749715
222 Ga0075429_100001297
223 Ga0075429_100002569
224 Ga0075435_100050665
225 Ga0111539_10546917
226 Ga0111539_11662132
227 Ga0105245_10000455
228 Ga0114129_10001339
229 Ga0114129_10324073
230 Ga0114129_10833645
231 Ga0114129_12039898
232 Ga0163162_11502515
233 Ga0213875_10095068
234 Ga0213875_10196008
235 Ga0207684_10070539
236 Ga0207663_10660848
237 Ga0207687_10001933
238 Ga0207700_10002836
239 Ga0207665_10200528
240 Ga0207689_11266324
241 Ga0207658_10082402
242 Ga0307514_10196205
243 Ga0307413_10164344
244 Ga0307410_10015943
245 Ga0307410_11081282
246 Ga0307406_11037705
247 Ga0307412_10366503
248 Ga0307409_100048007
249 Ga0307415_100012157
250 Ga0307415_100446197
251 Ga0373923_0503078
252 Ga0436364_0831806
253 Ga0436364_1026533
254 Ga0439450_002047
255 Ga0439464_0045338
256 Ga0439460_0013305
257 Ga0451577_0027576
258 Ga0439440_0044022
259 Ga0466972_0330932
260 Ga0453683_0789592
261 Ga0453684_0343073
262 Ga0451576_0176508
263 Ga0495590_0268112
264 Ga0495652_0166443
265 Ga0495667_0528113
266 Ga0495623_0626316
267 Ga0495604_0141308
268 Ga0495680_0061519
269 Ga0495685_057697
270 Ga0495684_0630231
271 Ga0495602_0213209
272 Ga0496101_0004714
273 Ga0496102_0029080
274 Ga0496105_0062695
275 Ga0496107_0285956
276 Ga0496114_0429373
277 Ga0496115_0012591
278 Ga0496121_0192520
279 Ga0496124_0445341
280 Ga0501031_0092537
281 Ga0501032_0047069
282 Ga0501033_0002967
283 Ga0501033_0017528
284 Ga0501034_0012247
285 Ga0501036_0003775
286 Ga0501036_0018904
287 Ga0501036_0157042
288 Ga0501037_0021451
289 Ga0501037_0392199
290 Ga0501038_0028534
291 Ga0501039_0005623
292 Ga0501039_0009402
293 Ga0501039_0063224
294 Ga0501039_0140829
295 Ga0501040_0018386
296 Ga0501040_0070293
297 Ga0501040_0111978
298 Ga0501041_0004840
299 Ga0501041_0014250
300 Ga0501041_0798367
301 Ga0501042_0008858
302 Ga0501042_0067676
303 Ga0501042_0326230
304 Ga0501043_0106524
305 Ga0501046_0021135
306 Ga0501046_0041823
307 Ga0501046_1216182
308 Ga0501047_0375643
309 Ga0501048_0061485
310 Ga0501048_0065529
311 Ga0501048_0181109
312 Ga0501048_0302493
313 Ga0501068_0068489
314 Ga0501068_0599915
315 Ga0501069_0574703
316 Ga0501070_0711394
317 Ga0501070_0886032
318 Ga0501071_0027485
319 Ga0501071_0065384
320 Ga0501071_0611586
321 Ga0501072_0002964
322 Ga0501072_0387288
323 Ga0501072_0771894
324 Ga0501074_0063456
325 Ga0501074_0073677
326 Ga0501074_0949757
327 Ga0501075_0003752
328 Ga0501075_0032087
329 Ga0501075_0237806
330 Ga0501076_0008391
331 Ga0501076_0252930
332 Ga0501076_0562848
333 Ga0501077_0000418
334 Ga0501077_0143390
335 Ga0501077_0264285
336 Ga0501079_0004007
337 Ga0501079_0010288
338 Ga0501079_0024211
339 Ga0501080_0259293
340 Ga0501080_0311947
341 Ga0501080_1030657
342 Ga0501081_0000854
343 Ga0501081_0048585
344 Ga0501081_0455034
345 Ga0501083_0026974
346 Ga0501035_0761146
347 Ga0501044_0052736
348 Ga0501044_0262620
349 Ga0501044_0766383
350 Ga0501045_0008544
351 Ga0501045_0026312
352 nmdc:mga00v17_75189_c1
353 nmdc:mga00v17_779328_c1
354 nmdc:mga04h51_113379_c1
355 nmdc:mga05p37_1019563_c1
356 nmdc:mga05p37_343_c1
357 nmdc:mga05p37_41624_c1
358 nmdc:mga09592_1351_c1
359 nmdc:mga09592_495_c1
360 nmdc:mga0qj67_1095_c1
361 nmdc:mga0qj67_74020_c1
362 nmdc:mga0qj67_7819_c1
363 nmdc:mga0qj67_93219_c1
364 nmdc:mga06r32_1044_c1
365 nmdc:mga06r32_398523_c1
366 nmdc:mga06r32_587310_c1
367 nmdc:mga06r32_875_c1
368 nmdc:mga08y16_1109657_c1
369 nmdc:mga0n895_697037_c1
370 nmdc:mga0a205_12180_c1
371 nmdc:mga0a205_850072_c1
372 Ga0495595_0104210
373 Ga0500616_0092906
374 Ga0501084_0013389
375 Ga0501084_0013824
376 Ga0501084_0125776
377 Ga0501082_0001475
378 Ga0501082_0002106
379 Ga0501082_0132198
380 Ga0501082_0338514
381 Ga0501082_0358607
382 Ga0501082_0635822
383 Ga0530510_0046668
384 Ga0530510_0053668
385 Ga0530510_0467525
386 2819746512
387 2867369602
388 2995470025
389 3003006950
390 3006426949

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

13

110

0.95

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

5

114

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9159 8 137
3lb5-assembly2.cif.gz_C crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.8975 6 137
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.8939 8 137
3o0m-assembly1.cif.gz_A crystal structure of a zn-bound histidine triad family protein from mycobacterium smegmatis 0.889 6 139
3imi-assembly2.cif.gz_C 2.01 angstrom resolution crystal structure of a hit family protein from bacillus anthracis str. 'ames ancestor' 0.8872 6 116
ID Description Score Start End Superfamily
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.927 4 109 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9248 19 107 3.30.428.10
af_F4K1R2_26_184_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9178 6 136 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9131 40 113 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9097 19 108 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A1F2X1A4-F1-model_v4 HIT family hydrolase 0.9734 5 101 GO:0009117
GO:0016787
AF-A0A358ZYK7-F1-model_v4 deleted 0.9663 22 138
AF-D2EFV4-F1-model_v4 Histidine triad (HIT) protein 0.961 6 138 GO:0003824
GO:0009117
GO:0016020
AF-A0A7J9YY17-F1-model_v4 HIT domain-containing protein 0.9601 1 108 GO:0003824
GO:0009117
AF-A0A0Q0RPY1-F1-model_v4 HIT domain-containing protein 0.9555 19 138 GO:0003824
GO:0009117

Map