F300497

General Info

Members Datasets Scaffolds Average Seq Length
195 119 390 100

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0184876|Ga0453684_0184876_1235_1597
Length 120
Sequence LRLVSKPKKYDFVYFGVEEMILEVAILDVIPSQEQDFESAFAKASGIIASMPGYISHQLQRCVEKQSRYILLVHWEKLEDHTVGFRGSEQYQEWRKLLHHFYDPFPMVEHYELIQDYNKL

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
97 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
98 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
117 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
118 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
119 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 1.03
Isolates 2.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.05
Rhizosphere 96.92
Stem 0
Stem Tuber 0
Unclassified 31.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0184876 3300044712 Bacteria 2443
2 SwRhRL2b_contig_2170388 2162886007 Bacteria 825
3 SwRhRL2b_contig_3459443 2162886007 Unclassified 1063
4 LJQas_1009324 3300000549 Bacteria 1183
5 Ga0065704_10124027 3300005289 Bacteria 1724
6 Ga0065704_10163008 3300005289 Unclassified 1341
7 Ga0065707_10000999 3300005295 Bacteria 8829
8 Ga0065707_10100407 3300005295 Bacteria 2932
9 Ga0065707_10141886 3300005295 Bacteria 1761
10 Ga0065707_10725579 3300005295 Unclassified 629
11 Ga0070658_11103148 3300005327 Bacteria 690
12 Ga0070683_100704899 3300005329 Unclassified 967
13 Ga0070670_100478872 3300005331 Bacteria 1105
14 Ga0068869_101096315 3300005334 Unclassified 696
15 Ga0070666_10270775 3300005335 Bacteria 1205
16 Ga0070689_100224369 3300005340 Bacteria 1542
17 Ga0070689_101362721 3300005340 Unclassified 640
18 Ga0070689_101638740 3300005340 Unclassified 585
19 Ga0070661_100989099 3300005344 Bacteria 697
20 Ga0070668_100045825 3300005347 Bacteria 3355
21 Ga0070675_100651555 3300005354 Unclassified 957
22 Ga0070659_101514288 3300005366 Unclassified 598
23 Ga0070667_101267611 3300005367 Bacteria 690
24 Ga0070701_10692617 3300005438 Unclassified 685
25 Ga0070701_10696244 3300005438 Bacteria 683
26 Ga0070711_100662500 3300005439 Bacteria 876
27 Ga0070705_101300737 3300005440 Unclassified 603
28 Ga0070694_101087029 3300005444 Unclassified 667
29 Ga0070706_100173570 3300005467 Bacteria 2013
30 Ga0070706_100521762 3300005467 Unclassified 1105
31 Ga0070707_101863994 3300005468 Unclassified 569
32 Ga0070698_100113592 3300005471 Bacteria 2673
33 Ga0070698_100356758 3300005471 Bacteria 1394
34 Ga0070698_100638762 3300005471 Unclassified 1005
35 Ga0070699_100015123 3300005518 Bacteria 6630
36 Ga0070699_100015273 3300005518 Bacteria 6599
37 Ga0070699_100513779 3300005518 Bacteria 1089
38 Ga0068853_100464817 3300005539 Bacteria 1191
39 Ga0070672_100373333 3300005543 Bacteria 1219
40 Ga0070695_100113153 3300005545 Unclassified 1845
41 Ga0070695_101210253 3300005545 Unclassified 621
42 Ga0070696_100115252 3300005546 Bacteria 1939
43 Ga0070696_100389994 3300005546 Bacteria 1087
44 Ga0070696_101247191 3300005546 Bacteria 629
45 Ga0068859_100031171 3300005617 Bacteria 5352
46 Ga0068859_100186058 3300005617 Bacteria 2161
47 Ga0068859_100336161 3300005617 Bacteria 1604
48 Ga0068859_100746408 3300005617 Unclassified 1068
49 Ga0068864_100221488 3300005618 Bacteria 1746
50 Ga0068870_10080621 3300005840 Bacteria 1798
51 Ga0068863_101392482 3300005841 Unclassified 709
52 Ga0068858_100131571 3300005842 Unclassified 2346
53 Ga0068858_100198220 3300005842 Bacteria 1898
54 Ga0068860_101154985 3300005843 Bacteria 794
55 Ga0068860_101393431 3300005843 Unclassified 722
56 Ga0068862_100148272 3300005844 Bacteria 2087
57 Ga0068862_100169883 3300005844 Bacteria 1952
58 Ga0068862_100867522 3300005844 Bacteria 885
59 Ga0068862_101607147 3300005844 Unclassified 657
60 Ga0081539_10000850 3300005985 Bacteria 58405
61 Ga0097621_102002975 3300006237 Unclassified 553
62 Ga0075428_100418106 3300006844 Unclassified 1436
63 Ga0075428_102696596 3300006844 Bacteria 506
64 Ga0075430_100066346 3300006846 Bacteria 3031
65 Ga0075430_100146859 3300006846 Bacteria 1964
66 Ga0075431_100695559 3300006847 Bacteria 995
67 Ga0075431_100895517 3300006847 Unclassified 857
68 Ga0075433_10007149 3300006852 Bacteria 8839
69 Ga0075433_11933391 3300006852 Unclassified 506
70 Ga0075434_100110438 3300006871 Unclassified 2760
71 Ga0075429_100001599 3300006880 Bacteria 18676
72 Ga0075429_100112231 3300006880 Bacteria 2382
73 Ga0068865_100014999 3300006881 Bacteria 4935
74 Ga0097620_100031172 3300006931 Bacteria 5352
75 Ga0097620_100186058 3300006931 Bacteria 2161
76 Ga0097620_100336157 3300006931 Bacteria 1604
77 Ga0105240_10805777 3300009093 Unclassified 1017
78 Ga0111539_13153647 3300009094 Unclassified 532
79 Ga0105247_10001515 3300009101 Bacteria 16614
80 Ga0105247_10258115 3300009101 Bacteria 1194
81 Ga0105247_10278435 3300009101 Unclassified 1153
82 Ga0105247_10908433 3300009101 Bacteria 681
83 Ga0114129_10000824 3300009147 Bacteria 40007
84 Ga0114129_10016852 3300009147 Bacteria 10404
85 Ga0114129_10060829 3300009147 Bacteria 5280
86 Ga0114129_10064617 3300009147 Bacteria 5107
87 Ga0114129_10104195 3300009147 Unclassified 3920
88 Ga0114129_10124924 3300009147 Bacteria 3538
89 Ga0114129_12307259 3300009147 Unclassified 646
90 Ga0105243_10880391 3300009148 Bacteria 889
91 Ga0105243_11402643 3300009148 Unclassified 719
92 Ga0105243_11700272 3300009148 Unclassified 660
93 Ga0105237_10686385 3300009545 Unclassified 1031
94 Ga0105238_10706677 3300009551 Unclassified 1020
95 Ga0105249_10154525 3300009553 Bacteria 2212
96 Ga0105249_10218054 3300009553 Bacteria 1876
97 Ga0105249_10572566 3300009553 Bacteria 1182
98 Ga0105246_10041092 3300011119 Bacteria 3124
99 Ga0105246_10966217 3300011119 Unclassified 769
100 Ga0157373_10015341 3300013100 Bacteria 5600
101 Ga0157374_10074491 3300013296 Bacteria 3206
102 Ga0157375_12171970 3300013308 Unclassified 661
103 Ga0163163_10039713 3300014325 Bacteria 4595
104 Ga0163163_10484267 3300014325 Unclassified 1298
105 Ga0157376_10116382 3300014969 Bacteria 2362
106 Ga0157376_10553676 3300014969 Bacteria 1138
107 Ga0207697_10294011 3300025315 Bacteria 720
108 Ga0207710_10001721 3300025900 Bacteria 10582
109 Ga0207710_10277402 3300025900 Unclassified 843
110 Ga0207645_10112304 3300025907 Bacteria 1765
111 Ga0207684_10958720 3300025910 Unclassified 717
112 Ga0207695_10741805 3300025913 Unclassified 862
113 Ga0207663_10299094 3300025916 Bacteria 1202
114 Ga0207657_10377042 3300025919 Bacteria 1117
115 Ga0207649_11131370 3300025920 Bacteria 618
116 Ga0207646_10793660 3300025922 Bacteria 843
117 Ga0207690_11152084 3300025932 Unclassified 647
118 Ga0207709_11643887 3300025935 Unclassified 534
119 Ga0207670_10167272 3300025936 Bacteria 1646
120 Ga0207670_10516591 3300025936 Bacteria 972
121 Ga0207704_10010153 3300025938 Bacteria 4577
122 Ga0207712_10137273 3300025961 Bacteria 1872
123 Ga0207712_11203379 3300025961 Bacteria 676
124 Ga0207712_11734932 3300025961 Unclassified 560
125 Ga0207668_10037060 3300025972 Bacteria 3260
126 Ga0207703_10157836 3300026035 Bacteria 1984
127 Ga0207708_11067659 3300026075 Bacteria 703
128 Ga0207676_10269572 3300026095 Bacteria 1541
129 Ga0207676_11209273 3300026095 Unclassified 749
130 Ga0207674_10332914 3300026116 Unclassified 1468
131 Ga0207675_100092465 3300026118 Bacteria 2845
132 Ga0268265_10596276 3300028380 Bacteria 1055
133 Ga0307413_10131903 3300031824 Bacteria 1712
134 Ga0307413_11654470 3300031824 Bacteria 570
135 Ga0307413_11711045 3300031824 Unclassified 561
136 Ga0307410_10295299 3300031852 Bacteria 1277
137 Ga0307412_10281096 3300031911 Bacteria 1307
138 Ga0307409_102442153 3300031995 Bacteria 552
139 Ga0307411_11463922 3300032005 Bacteria 627
140 Ga0373938_0170521 3300034957 Unclassified 589
141 Ga0373955_0418751 3300035172 Bacteria 815
142 Ga0373942_0264336 3300035207 Unclassified 588
143 Ga0373931_0237546 3300035691 Bacteria 1103
144 Ga0373937_0040496 3300036401 Bacteria 4247
145 Ga0373937_0058182 3300036401 Plasmid 3551
146 Ga0316584_0104651 3300036712 Bacteria 2118
147 Ga0395899_0026632 3300037312 Bacteria 4362
148 Ga0395900_0166051 3300037418 Bacteria 2249
149 Ga0395898_0017844 3300037466 Bacteria 7240
150 Ga0395905_0648780 3300037471 Bacteria 957
151 Ga0451807_1654358 3300041486 Bacteria 523
152 Ga0451843_0911798 3300041509 Unclassified 657
153 Ga0439443_031950 3300042003 Bacteria 871
154 Ga0451577_0242919 3300042876 Bacteria 1629
155 Ga0451577_0300848 3300042876 Bacteria 1454
156 Ga0451577_0307638 3300042876 Unclassified 1436
157 Ga0451577_1229833 3300042876 Bacteria 668
158 Ga0453683_0077172 3300044673 Bacteria 2086
159 Ga0453683_0120524 3300044673 Bacteria 1651
160 Ga0453683_1162425 3300044673 Unclassified 516
161 Ga0453684_0153047 3300044712 Bacteria 2738
162 Ga0453684_0295632 3300044712 Bacteria 1842
163 Ga0453684_0352289 3300044712 Unclassified 1659
164 Ga0453684_0597816 3300044712 Bacteria 1209
165 Ga0453684_1105726 3300044712 Bacteria 837
166 Ga0453684_2114388 3300044712 Unclassified 564
167 Ga0466959_0175925 3300045049 Bacteria 1499
168 Ga0451576_0018950 3300045051 Bacteria 7519
169 Ga0451576_0732050 3300045051 Bacteria 1039
170 Ga0495629_0157128 3300046459 Bacteria 1580
171 Ga0495636_0374885 3300047318 Bacteria 675
172 Ga0496114_1356314 3300048917 Bacteria 598
173 Ga0496115_0266162 3300048918 Bacteria 1409
174 Ga0496115_0421548 3300048918 Bacteria 1081
175 Ga0496116_0376042 3300048919 Bacteria 639
176 nmdc:mga05p37_1109281_c1 3300050507 Unclassified 828
177 nmdc:mga05p37_269_c1 3300050507 Bacteria 53887
178 nmdc:mga05p37_284970_c1 3300050507 Unclassified 1968
179 nmdc:mga05p37_400021_c1 3300050507 Bacteria 1604
180 nmdc:mga05p37_67724_c1 3300050507 Bacteria 4392
181 nmdc:mga09592_1535_c1 3300050508 Bacteria 18599
182 nmdc:mga09592_204263_c1 3300050508 Unclassified 1711
183 nmdc:mga0qj67_139326_c1 3300050509 Bacteria 1966
184 nmdc:mga0qj67_560035_c1 3300050509 Bacteria 916
185 nmdc:mga06r32_322690_c1 3300050510 Bacteria 1529
186 nmdc:mga06r32_644962_c1 3300050510 Bacteria 1027
187 nmdc:mga0n895_79617_c1 3300050512 Unclassified 3263
188 nmdc:mga0a205_1384114_c1 3300050515 Unclassified 551
189 nmdc:mga0a205_7999_c1 3300050515 Bacteria 9607
190 Ga0587085_186759 3300059506 Unclassified 500
191 Ga0587111_0156577 3300060346 Unclassified 616
192 2902052229 2902048731 Bacteria 4976191
193 2904762230 2904755435 Bacteria 7986759
194 2954021576 2954016120 Bacteria 6446024
195 2990711430 2990710928 Bacteria 5002431
196 Ga0453684_0184876
197 SwRhRL2b_contig_2170388
198 SwRhRL2b_contig_3459443
199 LJQas_1009324
200 Ga0065704_10124027
201 Ga0065704_10163008
202 Ga0065707_10000999
203 Ga0065707_10100407
204 Ga0065707_10141886
205 Ga0065707_10725579
206 Ga0070658_11103148
207 Ga0070683_100704899
208 Ga0070670_100478872
209 Ga0068869_101096315
210 Ga0070666_10270775
211 Ga0070689_100224369
212 Ga0070689_101362721
213 Ga0070689_101638740
214 Ga0070661_100989099
215 Ga0070668_100045825
216 Ga0070675_100651555
217 Ga0070659_101514288
218 Ga0070667_101267611
219 Ga0070701_10692617
220 Ga0070701_10696244
221 Ga0070711_100662500
222 Ga0070705_101300737
223 Ga0070694_101087029
224 Ga0070706_100173570
225 Ga0070706_100521762
226 Ga0070707_101863994
227 Ga0070698_100113592
228 Ga0070698_100356758
229 Ga0070698_100638762
230 Ga0070699_100015123
231 Ga0070699_100015273
232 Ga0070699_100513779
233 Ga0068853_100464817
234 Ga0070672_100373333
235 Ga0070695_100113153
236 Ga0070695_101210253
237 Ga0070696_100115252
238 Ga0070696_100389994
239 Ga0070696_101247191
240 Ga0068859_100031171
241 Ga0068859_100186058
242 Ga0068859_100336161
243 Ga0068859_100746408
244 Ga0068864_100221488
245 Ga0068870_10080621
246 Ga0068863_101392482
247 Ga0068858_100131571
248 Ga0068858_100198220
249 Ga0068860_101154985
250 Ga0068860_101393431
251 Ga0068862_100148272
252 Ga0068862_100169883
253 Ga0068862_100867522
254 Ga0068862_101607147
255 Ga0081539_10000850
256 Ga0097621_102002975
257 Ga0075428_100418106
258 Ga0075428_102696596
259 Ga0075430_100066346
260 Ga0075430_100146859
261 Ga0075431_100695559
262 Ga0075431_100895517
263 Ga0075433_10007149
264 Ga0075433_11933391
265 Ga0075434_100110438
266 Ga0075429_100001599
267 Ga0075429_100112231
268 Ga0068865_100014999
269 Ga0097620_100031172
270 Ga0097620_100186058
271 Ga0097620_100336157
272 Ga0105240_10805777
273 Ga0111539_13153647
274 Ga0105247_10001515
275 Ga0105247_10258115
276 Ga0105247_10278435
277 Ga0105247_10908433
278 Ga0114129_10000824
279 Ga0114129_10016852
280 Ga0114129_10060829
281 Ga0114129_10064617
282 Ga0114129_10104195
283 Ga0114129_10124924
284 Ga0114129_12307259
285 Ga0105243_10880391
286 Ga0105243_11402643
287 Ga0105243_11700272
288 Ga0105237_10686385
289 Ga0105238_10706677
290 Ga0105249_10154525
291 Ga0105249_10218054
292 Ga0105249_10572566
293 Ga0105246_10041092
294 Ga0105246_10966217
295 Ga0157373_10015341
296 Ga0157374_10074491
297 Ga0157375_12171970
298 Ga0163163_10039713
299 Ga0163163_10484267
300 Ga0157376_10116382
301 Ga0157376_10553676
302 Ga0207697_10294011
303 Ga0207710_10001721
304 Ga0207710_10277402
305 Ga0207645_10112304
306 Ga0207684_10958720
307 Ga0207695_10741805
308 Ga0207663_10299094
309 Ga0207657_10377042
310 Ga0207649_11131370
311 Ga0207646_10793660
312 Ga0207690_11152084
313 Ga0207709_11643887
314 Ga0207670_10167272
315 Ga0207670_10516591
316 Ga0207704_10010153
317 Ga0207712_10137273
318 Ga0207712_11203379
319 Ga0207712_11734932
320 Ga0207668_10037060
321 Ga0207703_10157836
322 Ga0207708_11067659
323 Ga0207676_10269572
324 Ga0207676_11209273
325 Ga0207674_10332914
326 Ga0207675_100092465
327 Ga0268265_10596276
328 Ga0307413_10131903
329 Ga0307413_11654470
330 Ga0307413_11711045
331 Ga0307410_10295299
332 Ga0307412_10281096
333 Ga0307409_102442153
334 Ga0307411_11463922
335 Ga0373938_0170521
336 Ga0373955_0418751
337 Ga0373942_0264336
338 Ga0373931_0237546
339 Ga0373937_0040496
340 Ga0373937_0058182
341 Ga0316584_0104651
342 Ga0395899_0026632
343 Ga0395900_0166051
344 Ga0395898_0017844
345 Ga0395905_0648780
346 Ga0451807_1654358
347 Ga0451843_0911798
348 Ga0439443_031950
349 Ga0451577_0242919
350 Ga0451577_0300848
351 Ga0451577_0307638
352 Ga0451577_1229833
353 Ga0453683_0077172
354 Ga0453683_0120524
355 Ga0453683_1162425
356 Ga0453684_0153047
357 Ga0453684_0295632
358 Ga0453684_0352289
359 Ga0453684_0597816
360 Ga0453684_1105726
361 Ga0453684_2114388
362 Ga0466959_0175925
363 Ga0451576_0018950
364 Ga0451576_0732050
365 Ga0495629_0157128
366 Ga0495636_0374885
367 Ga0496114_1356314
368 Ga0496115_0266162
369 Ga0496115_0421548
370 Ga0496116_0376042
371 nmdc:mga05p37_1109281_c1
372 nmdc:mga05p37_269_c1
373 nmdc:mga05p37_284970_c1
374 nmdc:mga05p37_400021_c1
375 nmdc:mga05p37_67724_c1
376 nmdc:mga09592_1535_c1
377 nmdc:mga09592_204263_c1
378 nmdc:mga0qj67_139326_c1
379 nmdc:mga0qj67_560035_c1
380 nmdc:mga06r32_322690_c1
381 nmdc:mga06r32_644962_c1
382 nmdc:mga0n895_79617_c1
383 nmdc:mga0a205_1384114_c1
384 nmdc:mga0a205_7999_c1
385 Ga0587085_186759
386 Ga0587111_0156577
387 2902052229
388 2904762230
389 2954021576
390 2990711430

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

20

97

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gz7-assembly1.cif.gz_B crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution 0.9727 2 94
3kg1-assembly3.cif.gz_A-2 crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a 0.894 2 97
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.8804 2 95
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.8755 2 95
4zos-assembly1.cif.gz_C 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.865 2 97
ID Description Score Start End Superfamily
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9595 2 94 3.30.70.100
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9111 2 94 3.30.70.100
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.894 2 97 3.30.70.100
1iujA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8796 1 98 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.878 1 92 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2E0ZKG5-F1-model_v4 Antibiotic biosynthesis monooxygenase 1.004 1 94 GO:0004497
AF-A0A2D6MZI6-F1-model_v4 Antibiotic biosynthesis monooxygenase 1.004 1 94 GO:0004497
AF-S7I6L3-F1-model_v4 Antibiotic biosynthesis monooxygenase 1.003 1 96 GO:0004497
AF-A0A6J4HF53-F1-model_v4 Uncharacterized protein YczJ 1.003 1 96
AF-A0A4Q6GG59-F1-model_v4 Antibiotic biosynthesis monooxygenase 1.002 1 97 GO:0004497

Map