F300326

General Info

Members Datasets Scaffolds Average Seq Length
195 122 195 258

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10001113|Ga0307413_100011133
Length 269
Sequence MADHPHIEIEQRGAVRWLWLNRPEVRNAFNDALIGGISSAFADVEASRETRVVVMAARGPVFCAGADLNWMRAMAQFSHADNHADALRVARMFHAVHSCSRPVIARIQGNAFGGGVGLAAACDIAVASESASFALTEVRLGIVAATISPHLVRAMGPRHAARYMLTGEKFTSADARAVGLVHETATLDELDAVIDGLVQQLLAASPAALAATKRLLADVVEVPMEDDVLLAATAKCIADARVSPEGREGLAAFLEKRAPAWVPRPADKP

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
83 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
84 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
85 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
86 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
87 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
88 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
97 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
98 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
111 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
114 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
119 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
120 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 4.1
Rhizosphere 89.23
Stem 0
Stem Tuber 0
Unclassified 5.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10226816 3300003323 Bacteria 1731
2 Ga0070658_10461050 3300005327 Bacteria 1096
3 Ga0070676_10125119 3300005328 Bacteria 1619
4 Ga0070676_10294534 3300005328 Bacteria 1098
5 Ga0070690_100004882 3300005330 Bacteria 7496
6 Ga0070690_100367620 3300005330 Bacteria 1048
7 Ga0070670_100021687 3300005331 Bacteria 5523
8 Ga0070677_10014936 3300005333 Bacteria 2744
9 Ga0070677_10091906 3300005333 Bacteria 1321
10 Ga0070682_100030109 3300005337 Bacteria 3273
11 Ga0070682_100060454 3300005337 Bacteria 2396
12 Ga0070682_100132705 3300005337 Bacteria 1687
13 Ga0070682_100148022 3300005337 Bacteria 1608
14 Ga0070689_100008171 3300005340 Bacteria 7353
15 Ga0070687_100119003 3300005343 Bacteria 1508
16 Ga0070669_100021427 3300005353 Bacteria 4618
17 Ga0070675_100140424 3300005354 Bacteria 2064
18 Ga0070675_100336344 3300005354 Bacteria 1336
19 Ga0070675_100622142 3300005354 Bacteria 980
20 Ga0070674_100093434 3300005356 Bacteria 2176
21 Ga0070674_100361478 3300005356 Bacteria 1175
22 Ga0070673_100023490 3300005364 Bacteria 4505
23 Ga0070673_100099586 3300005364 Bacteria 2391
24 Ga0070673_100392665 3300005364 Bacteria 1239
25 Ga0070701_10025582 3300005438 Bacteria 2867
26 Ga0070701_10109899 3300005438 Bacteria 1539
27 Ga0070701_10184328 3300005438 Bacteria 1224
28 Ga0070700_100052951 3300005441 Bacteria 2532
29 Ga0070700_100056788 3300005441 Bacteria 2455
30 Ga0070700_100077177 3300005441 Bacteria 2141
31 Ga0070700_100360568 3300005441 Bacteria 1081
32 Ga0070678_100013132 3300005456 Bacteria 5179
33 Ga0070685_10023767 3300005466 Bacteria 3359
34 Ga0070685_10130075 3300005466 Bacteria 1573
35 Ga0070672_100071007 3300005543 Bacteria 2768
36 Ga0070672_100106455 3300005543 Bacteria 2281
37 Ga0070672_100125975 3300005543 Bacteria 2101
38 Ga0070672_100155871 3300005543 Bacteria 1892
39 Ga0070686_100147711 3300005544 Bacteria 1643
40 Ga0070695_100065219 3300005545 Bacteria 2370
41 Ga0070696_100064392 3300005546 Bacteria 2569
42 Ga0070665_100006995 3300005548 Bacteria 11462
43 Ga0070665_100026513 3300005548 Bacteria 5836
44 Ga0070664_100019524 3300005564 Bacteria 5576
45 Ga0068857_100607284 3300005577 Bacteria 1034
46 Ga0068857_100881064 3300005577 Bacteria 858
47 Ga0070702_100092816 3300005615 Bacteria 1834
48 Ga0068859_100028861 3300005617 Bacteria 5564
49 Ga0068859_100168363 3300005617 Bacteria 2271
50 Ga0068864_100012062 3300005618 Bacteria 7139
51 Ga0068864_100642593 3300005618 Bacteria 1033
52 Ga0068861_100000527 3300005719 Bacteria 22405
53 Ga0068861_100057683 3300005719 Bacteria 2966
54 Ga0068861_100096257 3300005719 Bacteria 2345
55 Ga0068861_100161303 3300005719 Bacteria 1850
56 Ga0068861_100190980 3300005719 Bacteria 1712
57 Ga0068861_100405047 3300005719 Bacteria 1211
58 Ga0068870_10004311 3300005840 Bacteria 6124
59 Ga0068863_100372907 3300005841 Bacteria 1393
60 Ga0068863_100634900 3300005841 Bacteria 1058
61 Ga0068860_100022011 3300005843 Bacteria 6170
62 Ga0068862_100002808 3300005844 Bacteria 15261
63 Ga0068862_100201214 3300005844 Bacteria 1796
64 Ga0068862_100268119 3300005844 Bacteria 1561
65 Ga0081455_10001291 3300005937 Bacteria 31153
66 Ga0097621_100043205 3300006237 Bacteria 3633
67 Ga0068871_100214584 3300006358 Bacteria 1665
68 Ga0068865_100089323 3300006881 Bacteria 2231
69 Ga0068865_100610064 3300006881 Bacteria 923
70 Ga0097620_100028861 3300006931 Bacteria 5564
71 Ga0097620_100168356 3300006931 Bacteria 2271
72 Ga0111539_10014520 3300009094 Bacteria 9834
73 Ga0111539_10208527 3300009094 Bacteria 2277
74 Ga0105238_10501675 3300009551 Unclassified 1214
75 Ga0105249_10655250 3300009553 Bacteria 1108
76 Ga0163162_10228824 3300013306 Bacteria 1989
77 Ga0157375_10045542 3300013308 Bacteria 4270
78 Ga0163163_10171164 3300014325 Bacteria 2218
79 Ga0163163_10507758 3300014325 Bacteria 1267
80 Ga0157380_10079837 3300014326 Bacteria 2673
81 Ga0157380_10085584 3300014326 Bacteria 2588
82 Ga0157380_10249839 3300014326 Bacteria 1605
83 Ga0157380_10383042 3300014326 Bacteria 1328
84 Ga0157376_10607210 3300014969 Bacteria 1089
85 Ga0207682_10004656 3300025893 Bacteria 5700
86 Ga0207682_10028350 3300025893 Bacteria 2234
87 Ga0207643_10008303 3300025908 Bacteria 5572
88 Ga0207681_10090207 3300025923 Bacteria 2187
89 Ga0207670_10019714 3300025936 Bacteria 4126
90 Ga0207669_10117777 3300025937 Bacteria 1796
91 Ga0207704_10332259 3300025938 Bacteria 1177
92 Ga0207704_10351479 3300025938 Bacteria 1148
93 Ga0207691_10006675 3300025940 Bacteria 11133
94 Ga0207691_10009596 3300025940 Bacteria 9288
95 Ga0207691_10034105 3300025940 Bacteria 4736
96 Ga0207691_10272841 3300025940 Bacteria 1456
97 Ga0207691_10286177 3300025940 Bacteria 1418
98 Ga0207689_10193848 3300025942 Bacteria 1677
99 Ga0207679_10020315 3300025945 Bacteria 4481
100 Ga0207679_10477939 3300025945 Bacteria 1109
101 Ga0207651_10022523 3300025960 Bacteria 3854
102 Ga0207651_10076166 3300025960 Bacteria 2397
103 Ga0207678_10112459 3300026067 Bacteria 2323
104 Ga0207708_10013928 3300026075 Bacteria 6009
105 Ga0207708_10020362 3300026075 Bacteria 5003
106 Ga0207708_10054702 3300026075 Bacteria 3043
107 Ga0207708_10178748 3300026075 Bacteria 1684
108 Ga0207708_10185345 3300026075 Bacteria 1654
109 Ga0207641_10331215 3300026088 Bacteria 1446
110 Ga0207641_10707517 3300026088 Bacteria 992
111 Ga0207648_10012440 3300026089 Bacteria 7968
112 Ga0207648_10221612 3300026089 Bacteria 1681
113 Ga0207676_10009401 3300026095 Bacteria 6959
114 Ga0207676_10021767 3300026095 Bacteria 4707
115 Ga0207674_10619825 3300026116 Bacteria 1045
116 Ga0207675_100001153 3300026118 Bacteria 26238
117 Ga0207675_100001636 3300026118 Bacteria 22459
118 Ga0207675_100029297 3300026118 Bacteria 5130
119 Ga0207675_100067557 3300026118 Bacteria 3341
120 Ga0207683_10006907 3300026121 Bacteria 9716
121 Ga0207428_10257634 3300027907 Bacteria 1300
122 Ga0268266_10073141 3300028379 Bacteria 2974
123 Ga0268265_10016507 3300028380 Bacteria 5074
124 Ga0268264_10032444 3300028381 Bacteria 4286
125 Ga0307515_10242053 3300028794 Bacteria 1572
126 Ga0307513_10021256 3300031456 Bacteria 7664
127 Ga0307513_10053760 3300031456 Bacteria 4325
128 Ga0307513_10069763 3300031456 Bacteria 3677
129 Ga0307513_10075085 3300031456 Bacteria 3512
130 Ga0307509_10162718 3300031507 Bacteria 2126
131 Ga0307509_10297884 3300031507 Bacteria 1363
132 Ga0307413_10001113 3300031824 Bacteria 9831
133 Ga0307413_10020989 3300031824 Bacteria 3487
134 Ga0307410_10024441 3300031852 Bacteria 3774
135 Ga0307406_10068112 3300031901 Bacteria 2323
136 Ga0307407_10030285 3300031903 Bacteria 2918
137 Ga0307412_10294622 3300031911 Bacteria 1280
138 Ga0307416_100140427 3300032002 Bacteria 2195
139 Ga0307416_100447534 3300032002 Bacteria 1343
140 Ga0307414_10323258 3300032004 Bacteria 1314
141 Ga0307411_10092719 3300032005 Bacteria 2113
142 Ga0307415_100135893 3300032126 Bacteria 1870
143 Ga0316574_0149325 3300035398 Bacteria 1506
144 Ga0316574_0186672 3300035398 Bacteria 1333
145 Ga0373927_0343404 3300035695 Bacteria 984
146 Ga0373933_0054216 3300035724 Bacteria 2403
147 Ga0451787_692997 3300041441 Bacteria 1632
148 Ga0451791_0018926 3300041451 Bacteria 3959
149 Ga0451791_0251818 3300041451 Bacteria 1460
150 Ga0451797_1116037 3300041453 Bacteria 1168
151 Ga0451800_0307031 3300041459 Bacteria 1624
152 Ga0451807_1721450 3300041486 Bacteria 1774
153 Ga0451807_1912352 3300041486 Bacteria 1847
154 Ga0451833_0496971 3300041491 Bacteria 2481
155 Ga0451853_2615918 3300041512 Bacteria 1093
156 Ga0450895_004212 3300042132 Bacteria 1131
157 Ga0453684_0267755 3300044712 Bacteria 1954
158 Ga0495590_0030590 3300046457 Bacteria 1886
159 Ga0495638_0003097 3300046460 Bacteria 13188
160 Ga0495638_0021454 3300046460 Bacteria 4257
161 Ga0495584_0141444 3300046491 Bacteria 1222
162 Ga0495594_0265811 3300046499 Bacteria 977
163 Ga0495616_0080265 3300046513 Bacteria 1562
164 Ga0495632_0068161 3300046519 Bacteria 1715
165 Ga0495632_0130412 3300046519 Bacteria 1170
166 Ga0495656_0023776 3300046615 Bacteria 2414
167 Ga0495625_0042639 3300046660 Bacteria 3296
168 Ga0495625_0043737 3300046660 Bacteria 3247
169 Ga0495625_0186771 3300046660 Bacteria 1375
170 Ga0495649_0106356 3300046694 Bacteria 1489
171 Ga0495672_0013080 3300047320 Bacteria 5743
172 Ga0495686_0272455 3300047472 Bacteria 943
173 Ga0496104_0848472 3300048907 Bacteria 819
174 Ga0501042_0051946 3300049578 Bacteria 2924
175 Ga0501046_0070641 3300049580 Bacteria 2714
176 Ga0501047_0002894 3300049581 Bacteria 16284
177 Ga0501047_0549545 3300049581 Bacteria 979
178 Ga0501070_0249395 3300049586 Bacteria 1452
179 Ga0501071_0146495 3300049587 Bacteria 1760
180 Ga0501073_0020089 3300049589 Bacteria 4816
181 Ga0501074_0006860 3300049590 Bacteria 8224
182 Ga0501075_0128334 3300049591 Bacteria 1931
183 Ga0501076_0036591 3300049592 Bacteria 3846
184 Ga0501077_0077523 3300049593 Bacteria 2105
185 Ga0501079_0015170 3300049741 Bacteria 5875
186 Ga0501080_0005108 3300049742 Bacteria 11690
187 Ga0501080_0014601 3300049742 Bacteria 7235
188 Ga0501083_0000842 3300049744 Bacteria 20163
189 nmdc:mga08y16_145252_c1 3300050511 Bacteria 2466
190 nmdc:mga08y16_265194_c1 3300050511 Bacteria 1773
191 Ga0500568_0023236 3300053139 Bacteria 2639
192 Ga0500622_0005990 3300053156 Bacteria 7146
193 Ga0500611_033459 3300053727 Bacteria 1082
194 Ga0501084_0314026 3300054114 Bacteria 1324
195 Ga0501082_0018356 3300060353 Bacteria 6024

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0848472 Ga0496104_0848472_110_808 232
2 3300035398 Ga0316574_0186672 Ga0316574_0186672_450_1253 238
3 3300049578 Ga0501042_0051946 Ga0501042_0051946_1859_2653 238
4 3300035398 Ga0316574_0149325 Ga0316574_0149325_152_955 239
5 3300047472 Ga0495686_0272455 Ga0495686_0272455_208_930 240
6 3300005441 Ga0070700_100056788 Ga0070700_1000567882 242
7 3300005719 Ga0068861_100000527 Ga0068861_10000052714 242
8 3300026075 Ga0207708_10054702 Ga0207708_100547022 242
9 3300026118 Ga0207675_100001636 Ga0207675_1000016369 242
10 3300042132 Ga0450895_004212 Ga0450895_004212_390_1121 243
11 3300005337 Ga0070682_100060454 Ga0070682_1000604542 246
12 3300031911 Ga0307412_10294622 Ga0307412_102946222 246
13 3300046457 Ga0495590_0030590 Ga0495590_0030590_856_1653 246
14 3300046491 Ga0495584_0141444 Ga0495584_0141444_27_824 246
15 3300046519 Ga0495632_0068161 Ga0495632_0068161_474_1271 246
16 3300046660 Ga0495625_0042639 Ga0495625_0042639_1298_2095 246
17 3300005327 Ga0070658_10461050 Ga0070658_104610501 247
18 3300005337 Ga0070682_100030109 Ga0070682_1000301092 247
19 3300005937 Ga0081455_10001291 Ga0081455_1000129117 247
20 3300005719 Ga0068861_100057683 Ga0068861_1000576832 249
21 3300005844 Ga0068862_100201214 Ga0068862_1002012141 249
22 3300005328 Ga0070676_10294534 Ga0070676_102945342 250
23 3300005333 Ga0070677_10091906 Ga0070677_100919062 250
24 3300005353 Ga0070669_100021427 Ga0070669_1000214272 250
25 3300005354 Ga0070675_100140424 Ga0070675_1001404242 250
26 3300005354 Ga0070675_100622142 Ga0070675_1006221422 250
27 3300005356 Ga0070674_100093434 Ga0070674_1000934342 250
28 3300005364 Ga0070673_100099586 Ga0070673_1000995862 250
29 3300005441 Ga0070700_100052951 Ga0070700_1000529512 250
30 3300005456 Ga0070678_100013132 Ga0070678_1000131325 250
31 3300005543 Ga0070672_100125975 Ga0070672_1001259752 250
32 3300005543 Ga0070672_100155871 Ga0070672_1001558712 250
33 3300005564 Ga0070664_100019524 Ga0070664_1000195244 250
34 3300014325 Ga0163163_10171164 Ga0163163_101711642 250
35 3300014326 Ga0157380_10079837 Ga0157380_100798372 250
36 3300014326 Ga0157380_10085584 Ga0157380_100855842 250
37 3300025893 Ga0207682_10028350 Ga0207682_100283502 250
38 3300025923 Ga0207681_10090207 Ga0207681_100902072 250
39 3300025937 Ga0207669_10117777 Ga0207669_101177772 250
40 3300025940 Ga0207691_10006675 Ga0207691_100066755 250
41 3300025940 Ga0207691_10272841 Ga0207691_102728411 250
42 3300025940 Ga0207691_10286177 Ga0207691_102861772 250
43 3300025945 Ga0207679_10020315 Ga0207679_100203154 250
44 3300025960 Ga0207651_10076166 Ga0207651_100761662 250
45 3300026075 Ga0207708_10013928 Ga0207708_100139285 250
46 3300026089 Ga0207648_10221612 Ga0207648_102216122 250
47 3300026118 Ga0207675_100067557 Ga0207675_1000675572 250
48 3300026121 Ga0207683_10006907 Ga0207683_100069072 250
49 3300041441 Ga0451787_692997 Ga0451787_692997_629_1438 250
50 3300041451 Ga0451791_0251818 Ga0451791_0251818_378_1187 250
51 3300041459 Ga0451800_0307031 Ga0451800_0307031_530_1339 250
52 3300005330 Ga0070690_100367620 Ga0070690_1003676202 251
53 3300005331 Ga0070670_100021687 Ga0070670_1000216874 251
54 3300005333 Ga0070677_10014936 Ga0070677_100149362 251
55 3300005340 Ga0070689_100008171 Ga0070689_1000081711 251
56 3300005343 Ga0070687_100119003 Ga0070687_1001190032 251
57 3300005354 Ga0070675_100336344 Ga0070675_1003363442 251
58 3300005356 Ga0070674_100361478 Ga0070674_1003614781 251
59 3300005364 Ga0070673_100392665 Ga0070673_1003926652 251
60 3300005438 Ga0070701_10025582 Ga0070701_100255822 251
61 3300005438 Ga0070701_10109899 Ga0070701_101098991 251
62 3300005438 Ga0070701_10184328 Ga0070701_101843282 251
63 3300005441 Ga0070700_100077177 Ga0070700_1000771772 251
64 3300005466 Ga0070685_10023767 Ga0070685_100237673 251
65 3300005543 Ga0070672_100106455 Ga0070672_1001064552 251
66 3300005544 Ga0070686_100147711 Ga0070686_1001477112 251
67 3300005615 Ga0070702_100092816 Ga0070702_1000928162 251
68 3300005617 Ga0068859_100028861 Ga0068859_1000288613 251
69 3300005617 Ga0068859_100168363 Ga0068859_1001683632 251
70 3300005618 Ga0068864_100012062 Ga0068864_1000120623 251
71 3300005618 Ga0068864_100642593 Ga0068864_1006425931 251
72 3300005719 Ga0068861_100096257 Ga0068861_1000962572 251
73 3300005719 Ga0068861_100161303 Ga0068861_1001613032 251
74 3300005840 Ga0068870_10004311 Ga0068870_100043112 251
75 3300005841 Ga0068863_100372907 Ga0068863_1003729072 251
76 3300005844 Ga0068862_100268119 Ga0068862_1002681192 251
77 3300006881 Ga0068865_100089323 Ga0068865_1000893232 251
78 3300006931 Ga0097620_100028861 Ga0097620_1000288613 251
79 3300006931 Ga0097620_100168356 Ga0097620_1001683562 251
80 3300014325 Ga0163163_10507758 Ga0163163_105077582 251
81 3300014326 Ga0157380_10249839 Ga0157380_102498392 251
82 3300025893 Ga0207682_10004656 Ga0207682_100046566 251
83 3300025908 Ga0207643_10008303 Ga0207643_100083032 251
84 3300025936 Ga0207670_10019714 Ga0207670_100197144 251
85 3300025940 Ga0207691_10009596 Ga0207691_100095966 251
86 3300026075 Ga0207708_10020362 Ga0207708_100203623 251
87 3300026075 Ga0207708_10178748 Ga0207708_101787482 251
88 3300026088 Ga0207641_10331215 Ga0207641_103312152 251
89 3300026089 Ga0207648_10012440 Ga0207648_100124406 251
90 3300026095 Ga0207676_10009401 Ga0207676_100094014 251
91 3300026095 Ga0207676_10021767 Ga0207676_100217673 251
92 3300026118 Ga0207675_100001153 Ga0207675_10000115312 251
93 3300026118 Ga0207675_100029297 Ga0207675_1000292974 251
94 3300031456 Ga0307513_10053760 Ga0307513_100537602 251
95 3300032002 Ga0307416_100447534 Ga0307416_1004475342 251
96 3300046615 Ga0495656_0023776 Ga0495656_0023776_291_1085 251
97 3300005330 Ga0070690_100004882 Ga0070690_1000048822 252
98 3300005364 Ga0070673_100023490 Ga0070673_1000234903 252
99 3300005543 Ga0070672_100071007 Ga0070672_1000710072 252
100 3300005545 Ga0070695_100065219 Ga0070695_1000652192 252
101 3300005546 Ga0070696_100064392 Ga0070696_1000643922 252
102 3300013308 Ga0157375_10045542 Ga0157375_100455422 252
103 3300014326 Ga0157380_10383042 Ga0157380_103830422 252
104 3300025938 Ga0207704_10332259 Ga0207704_103322592 252
105 3300025940 Ga0207691_10034105 Ga0207691_100341052 252
106 3300025942 Ga0207689_10193848 Ga0207689_101938482 252
107 3300025960 Ga0207651_10022523 Ga0207651_100225232 252
108 3300026067 Ga0207678_10112459 Ga0207678_101124591 252
109 3300028794 Ga0307515_10242053 Ga0307515_102420532 252
110 3300031456 Ga0307513_10075085 Ga0307513_100750851 252
111 3300031507 Ga0307509_10297884 Ga0307509_102978842 252
112 3300031824 Ga0307413_10020989 Ga0307413_100209892 252
113 3300031901 Ga0307406_10068112 Ga0307406_100681122 252
114 3300041512 Ga0451853_2615918 Ga0451853_2615918_161_973 252
115 3300046519 Ga0495632_0130412 Ga0495632_0130412_215_1027 252
116 3300046660 Ga0495625_0043737 Ga0495625_0043737_1640_2434 252
117 3300046660 Ga0495625_0186771 Ga0495625_0186771_127_921 252
118 3300005337 Ga0070682_100148022 Ga0070682_1001480222 253
119 3300005577 Ga0068857_100881064 Ga0068857_1008810641 254
120 3300009094 Ga0111539_10208527 Ga0111539_102085272 254
121 3300050511 nmdc:mga08y16_265194_c1 nmdc:mga08y16_265194_c1_209_1018 254
122 3300025938 Ga0207704_10351479 Ga0207704_103514792 259
123 3300046694 Ga0495649_0106356 Ga0495649_0106356_523_1308 259
124 3300005577 Ga0068857_100607284 Ga0068857_1006072841 260
125 3300005843 Ga0068860_100022011 Ga0068860_1000220114 260
126 3300005844 Ga0068862_100002808 Ga0068862_10000280815 260
127 3300009551 Ga0105238_10501675 Ga0105238_105016752 260
128 3300009553 Ga0105249_10655250 Ga0105249_106552502 260
129 3300026116 Ga0207674_10619825 Ga0207674_106198251 260
130 3300028380 Ga0268265_10016507 Ga0268265_100165073 260
131 3300028381 Ga0268264_10032444 Ga0268264_100324443 260
132 3300035695 Ga0373927_0343404 Ga0373927_0343404_36_839 260
133 3300035724 Ga0373933_0054216 Ga0373933_0054216_1411_2214 260
134 3300046499 Ga0495594_0265811 Ga0495594_0265811_54_851 260
135 3300047320 Ga0495672_0013080 Ga0495672_0013080_4085_4867 260
136 3300049581 Ga0501047_0002894 Ga0501047_0002894_9783_10583 260
137 3300049742 Ga0501080_0014601 Ga0501080_0014601_5068_5865 260
138 3300049744 Ga0501083_0000842 Ga0501083_0000842_9332_10129 260
139 3300060353 Ga0501082_0018356 Ga0501082_0018356_4975_5772 260
140 3300044712 Ga0453684_0267755 Ga0453684_0267755_779_1573 261
141 3300003323 rootH1_10226816 rootH1_102268161 262
142 3300005328 Ga0070676_10125119 Ga0070676_101251192 262
143 3300005337 Ga0070682_100132705 Ga0070682_1001327052 262
144 3300005441 Ga0070700_100360568 Ga0070700_1003605681 262
145 3300005466 Ga0070685_10130075 Ga0070685_101300752 262
146 3300005548 Ga0070665_100006995 Ga0070665_1000069957 262
147 3300005548 Ga0070665_100026513 Ga0070665_1000265132 262
148 3300005719 Ga0068861_100190980 Ga0068861_1001909802 262
149 3300005719 Ga0068861_100405047 Ga0068861_1004050472 262
150 3300005841 Ga0068863_100634900 Ga0068863_1006349002 262
151 3300006237 Ga0097621_100043205 Ga0097621_1000432052 262
152 3300006358 Ga0068871_100214584 Ga0068871_1002145842 262
153 3300006881 Ga0068865_100610064 Ga0068865_1006100642 262
154 3300009094 Ga0111539_10014520 Ga0111539_100145205 262
155 3300013306 Ga0163162_10228824 Ga0163162_102288241 262
156 3300014969 Ga0157376_10607210 Ga0157376_106072102 262
157 3300025945 Ga0207679_10477939 Ga0207679_104779392 262
158 3300026075 Ga0207708_10185345 Ga0207708_101853452 262
159 3300026088 Ga0207641_10707517 Ga0207641_107075171 262
160 3300027907 Ga0207428_10257634 Ga0207428_102576342 262
161 3300028379 Ga0268266_10073141 Ga0268266_100731412 262
162 3300031456 Ga0307513_10021256 Ga0307513_100212562 262
163 3300031456 Ga0307513_10069763 Ga0307513_100697633 262
164 3300031507 Ga0307509_10162718 Ga0307509_101627182 262
165 3300031824 Ga0307413_10001113 Ga0307413_100011133 262
166 3300031852 Ga0307410_10024441 Ga0307410_100244413 262
167 3300031903 Ga0307407_10030285 Ga0307407_100302853 262
168 3300032002 Ga0307416_100140427 Ga0307416_1001404272 262
169 3300032004 Ga0307414_10323258 Ga0307414_103232582 262
170 3300032005 Ga0307411_10092719 Ga0307411_100927192 262
171 3300032126 Ga0307415_100135893 Ga0307415_1001358932 262
172 3300041451 Ga0451791_0018926 Ga0451791_0018926_884_1681 262
173 3300041453 Ga0451797_1116037 Ga0451797_1116037_251_1048 262
174 3300041486 Ga0451807_1721450 Ga0451807_1721450_483_1280 262
175 3300041486 Ga0451807_1912352 Ga0451807_1912352_669_1463 262
176 3300041491 Ga0451833_0496971 Ga0451833_0496971_1472_2269 262
177 3300046460 Ga0495638_0003097 Ga0495638_0003097_201_995 262
178 3300046460 Ga0495638_0021454 Ga0495638_0021454_1111_1905 262
179 3300046513 Ga0495616_0080265 Ga0495616_0080265_452_1246 262
180 3300049580 Ga0501046_0070641 Ga0501046_0070641_658_1446 262
181 3300049581 Ga0501047_0549545 Ga0501047_0549545_35_823 262
182 3300049586 Ga0501070_0249395 Ga0501070_0249395_473_1267 262
183 3300049587 Ga0501071_0146495 Ga0501071_0146495_874_1668 262
184 3300049589 Ga0501073_0020089 Ga0501073_0020089_2833_3627 262
185 3300049590 Ga0501074_0006860 Ga0501074_0006860_3044_3838 262
186 3300049591 Ga0501075_0128334 Ga0501075_0128334_267_1061 262
187 3300049592 Ga0501076_0036591 Ga0501076_0036591_2522_3316 262
188 3300049593 Ga0501077_0077523 Ga0501077_0077523_833_1627 262
189 3300049741 Ga0501079_0015170 Ga0501079_0015170_3481_4275 262
190 3300049742 Ga0501080_0005108 Ga0501080_0005108_3944_4738 262
191 3300050511 nmdc:mga08y16_145252_c1 nmdc:mga08y16_145252_c1_736_1530 262
192 3300053139 Ga0500568_0023236 Ga0500568_0023236_482_1270 262
193 3300053156 Ga0500622_0005990 Ga0500622_0005990_1846_2634 262
194 3300053727 Ga0500611_033459 Ga0500611_033459_80_874 262
195 3300054114 Ga0501084_0314026 Ga0501084_0314026_49_843 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

10

264

0.93

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

15

262

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lk5-assembly1.cif.gz_B crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9452 3 255
6lvo-assembly1.cif.gz_A enoyl-coa isomerase (boeci) from bosea sp. pamc 26642 0.9404 3 251
3pea-assembly2.cif.gz_F crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' 0.9379 3 260
3pea-assembly2.cif.gz_D crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' 0.9365 3 260
4knp-assembly1.cif.gz_A crystal structure of a putative enoyl-coa hydratase (psi-nysgrc-019597) from mycobacterium avium paratuberculosis k-10 0.9348 4 260
ID Description Score Start End Superfamily
3i47A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9733 1 202 3.90.226.10
3mybC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9678 3 202 3.90.226.10
3i47A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9639 1 202 3.90.226.10
3mybC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9537 3 202 3.90.226.10
1uiyA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9505 4 202 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A1F4DU87-F1-model_v4 Enoyl-CoA hydratase 0.9918 3 181 GO:0003824
GO:0008300
AF-A0A6L7ZWB8-F1-model_v4 Enoyl-CoA hydratase 0.9914 1 197 GO:0008300
AF-A0A537VV39-F1-model_v4 Enoyl-CoA hydratase 0.9896 2 173 GO:0008300
AF-A0A3S1LET7-F1-model_v4 deleted 0.9885 3 183
AF-A0A536URT3-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein (EC 4.2.1.17) 0.9881 5 198 GO:0004300
GO:0008300
GO:0016853

Feature Viewer

pLDDT pTM Quality
94.53 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map