F300326
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 195 | 122 | 195 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300031824|Ga0307413_10001113|Ga0307413_100011133 |
| Length | 269 |
| Sequence | MADHPHIEIEQRGAVRWLWLNRPEVRNAFNDALIGGISSAFADVEASRETRVVVMAARGPVFCAGADLNWMRAMAQFSHADNHADALRVARMFHAVHSCSRPVIARIQGNAFGGGVGLAAACDIAVASESASFALTEVRLGIVAATISPHLVRAMGPRHAARYMLTGEKFTSADARAVGLVHETATLDELDAVIDGLVQQLLAASPAALAATKRLLADVVEVPMEDDVLLAATAKCIADARVSPEGREGLAAFLEKRAPAWVPRPADKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 29 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 36 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 65 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 69 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 70 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 71 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 72 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 73 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 74 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 75 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 76 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 77 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 78 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 79 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 80 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 81 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 82 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 83 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 84 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 85 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 86 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 87 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 88 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 89 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 90 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 91 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 92 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 104 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 105 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 106 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 107 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 108 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 119 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 120 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 121 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.54 |
| Nodule | 0 |
| Rhizoplane | 4.1 |
| Rhizosphere | 89.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10226816 | 3300003323 | Bacteria | 1731 |
| 2 | Ga0070658_10461050 | 3300005327 | Bacteria | 1096 |
| 3 | Ga0070676_10125119 | 3300005328 | Bacteria | 1619 |
| 4 | Ga0070676_10294534 | 3300005328 | Bacteria | 1098 |
| 5 | Ga0070690_100004882 | 3300005330 | Bacteria | 7496 |
| 6 | Ga0070690_100367620 | 3300005330 | Bacteria | 1048 |
| 7 | Ga0070670_100021687 | 3300005331 | Bacteria | 5523 |
| 8 | Ga0070677_10014936 | 3300005333 | Bacteria | 2744 |
| 9 | Ga0070677_10091906 | 3300005333 | Bacteria | 1321 |
| 10 | Ga0070682_100030109 | 3300005337 | Bacteria | 3273 |
| 11 | Ga0070682_100060454 | 3300005337 | Bacteria | 2396 |
| 12 | Ga0070682_100132705 | 3300005337 | Bacteria | 1687 |
| 13 | Ga0070682_100148022 | 3300005337 | Bacteria | 1608 |
| 14 | Ga0070689_100008171 | 3300005340 | Bacteria | 7353 |
| 15 | Ga0070687_100119003 | 3300005343 | Bacteria | 1508 |
| 16 | Ga0070669_100021427 | 3300005353 | Bacteria | 4618 |
| 17 | Ga0070675_100140424 | 3300005354 | Bacteria | 2064 |
| 18 | Ga0070675_100336344 | 3300005354 | Bacteria | 1336 |
| 19 | Ga0070675_100622142 | 3300005354 | Bacteria | 980 |
| 20 | Ga0070674_100093434 | 3300005356 | Bacteria | 2176 |
| 21 | Ga0070674_100361478 | 3300005356 | Bacteria | 1175 |
| 22 | Ga0070673_100023490 | 3300005364 | Bacteria | 4505 |
| 23 | Ga0070673_100099586 | 3300005364 | Bacteria | 2391 |
| 24 | Ga0070673_100392665 | 3300005364 | Bacteria | 1239 |
| 25 | Ga0070701_10025582 | 3300005438 | Bacteria | 2867 |
| 26 | Ga0070701_10109899 | 3300005438 | Bacteria | 1539 |
| 27 | Ga0070701_10184328 | 3300005438 | Bacteria | 1224 |
| 28 | Ga0070700_100052951 | 3300005441 | Bacteria | 2532 |
| 29 | Ga0070700_100056788 | 3300005441 | Bacteria | 2455 |
| 30 | Ga0070700_100077177 | 3300005441 | Bacteria | 2141 |
| 31 | Ga0070700_100360568 | 3300005441 | Bacteria | 1081 |
| 32 | Ga0070678_100013132 | 3300005456 | Bacteria | 5179 |
| 33 | Ga0070685_10023767 | 3300005466 | Bacteria | 3359 |
| 34 | Ga0070685_10130075 | 3300005466 | Bacteria | 1573 |
| 35 | Ga0070672_100071007 | 3300005543 | Bacteria | 2768 |
| 36 | Ga0070672_100106455 | 3300005543 | Bacteria | 2281 |
| 37 | Ga0070672_100125975 | 3300005543 | Bacteria | 2101 |
| 38 | Ga0070672_100155871 | 3300005543 | Bacteria | 1892 |
| 39 | Ga0070686_100147711 | 3300005544 | Bacteria | 1643 |
| 40 | Ga0070695_100065219 | 3300005545 | Bacteria | 2370 |
| 41 | Ga0070696_100064392 | 3300005546 | Bacteria | 2569 |
| 42 | Ga0070665_100006995 | 3300005548 | Bacteria | 11462 |
| 43 | Ga0070665_100026513 | 3300005548 | Bacteria | 5836 |
| 44 | Ga0070664_100019524 | 3300005564 | Bacteria | 5576 |
| 45 | Ga0068857_100607284 | 3300005577 | Bacteria | 1034 |
| 46 | Ga0068857_100881064 | 3300005577 | Bacteria | 858 |
| 47 | Ga0070702_100092816 | 3300005615 | Bacteria | 1834 |
| 48 | Ga0068859_100028861 | 3300005617 | Bacteria | 5564 |
| 49 | Ga0068859_100168363 | 3300005617 | Bacteria | 2271 |
| 50 | Ga0068864_100012062 | 3300005618 | Bacteria | 7139 |
| 51 | Ga0068864_100642593 | 3300005618 | Bacteria | 1033 |
| 52 | Ga0068861_100000527 | 3300005719 | Bacteria | 22405 |
| 53 | Ga0068861_100057683 | 3300005719 | Bacteria | 2966 |
| 54 | Ga0068861_100096257 | 3300005719 | Bacteria | 2345 |
| 55 | Ga0068861_100161303 | 3300005719 | Bacteria | 1850 |
| 56 | Ga0068861_100190980 | 3300005719 | Bacteria | 1712 |
| 57 | Ga0068861_100405047 | 3300005719 | Bacteria | 1211 |
| 58 | Ga0068870_10004311 | 3300005840 | Bacteria | 6124 |
| 59 | Ga0068863_100372907 | 3300005841 | Bacteria | 1393 |
| 60 | Ga0068863_100634900 | 3300005841 | Bacteria | 1058 |
| 61 | Ga0068860_100022011 | 3300005843 | Bacteria | 6170 |
| 62 | Ga0068862_100002808 | 3300005844 | Bacteria | 15261 |
| 63 | Ga0068862_100201214 | 3300005844 | Bacteria | 1796 |
| 64 | Ga0068862_100268119 | 3300005844 | Bacteria | 1561 |
| 65 | Ga0081455_10001291 | 3300005937 | Bacteria | 31153 |
| 66 | Ga0097621_100043205 | 3300006237 | Bacteria | 3633 |
| 67 | Ga0068871_100214584 | 3300006358 | Bacteria | 1665 |
| 68 | Ga0068865_100089323 | 3300006881 | Bacteria | 2231 |
| 69 | Ga0068865_100610064 | 3300006881 | Bacteria | 923 |
| 70 | Ga0097620_100028861 | 3300006931 | Bacteria | 5564 |
| 71 | Ga0097620_100168356 | 3300006931 | Bacteria | 2271 |
| 72 | Ga0111539_10014520 | 3300009094 | Bacteria | 9834 |
| 73 | Ga0111539_10208527 | 3300009094 | Bacteria | 2277 |
| 74 | Ga0105238_10501675 | 3300009551 | Unclassified | 1214 |
| 75 | Ga0105249_10655250 | 3300009553 | Bacteria | 1108 |
| 76 | Ga0163162_10228824 | 3300013306 | Bacteria | 1989 |
| 77 | Ga0157375_10045542 | 3300013308 | Bacteria | 4270 |
| 78 | Ga0163163_10171164 | 3300014325 | Bacteria | 2218 |
| 79 | Ga0163163_10507758 | 3300014325 | Bacteria | 1267 |
| 80 | Ga0157380_10079837 | 3300014326 | Bacteria | 2673 |
| 81 | Ga0157380_10085584 | 3300014326 | Bacteria | 2588 |
| 82 | Ga0157380_10249839 | 3300014326 | Bacteria | 1605 |
| 83 | Ga0157380_10383042 | 3300014326 | Bacteria | 1328 |
| 84 | Ga0157376_10607210 | 3300014969 | Bacteria | 1089 |
| 85 | Ga0207682_10004656 | 3300025893 | Bacteria | 5700 |
| 86 | Ga0207682_10028350 | 3300025893 | Bacteria | 2234 |
| 87 | Ga0207643_10008303 | 3300025908 | Bacteria | 5572 |
| 88 | Ga0207681_10090207 | 3300025923 | Bacteria | 2187 |
| 89 | Ga0207670_10019714 | 3300025936 | Bacteria | 4126 |
| 90 | Ga0207669_10117777 | 3300025937 | Bacteria | 1796 |
| 91 | Ga0207704_10332259 | 3300025938 | Bacteria | 1177 |
| 92 | Ga0207704_10351479 | 3300025938 | Bacteria | 1148 |
| 93 | Ga0207691_10006675 | 3300025940 | Bacteria | 11133 |
| 94 | Ga0207691_10009596 | 3300025940 | Bacteria | 9288 |
| 95 | Ga0207691_10034105 | 3300025940 | Bacteria | 4736 |
| 96 | Ga0207691_10272841 | 3300025940 | Bacteria | 1456 |
| 97 | Ga0207691_10286177 | 3300025940 | Bacteria | 1418 |
| 98 | Ga0207689_10193848 | 3300025942 | Bacteria | 1677 |
| 99 | Ga0207679_10020315 | 3300025945 | Bacteria | 4481 |
| 100 | Ga0207679_10477939 | 3300025945 | Bacteria | 1109 |
| 101 | Ga0207651_10022523 | 3300025960 | Bacteria | 3854 |
| 102 | Ga0207651_10076166 | 3300025960 | Bacteria | 2397 |
| 103 | Ga0207678_10112459 | 3300026067 | Bacteria | 2323 |
| 104 | Ga0207708_10013928 | 3300026075 | Bacteria | 6009 |
| 105 | Ga0207708_10020362 | 3300026075 | Bacteria | 5003 |
| 106 | Ga0207708_10054702 | 3300026075 | Bacteria | 3043 |
| 107 | Ga0207708_10178748 | 3300026075 | Bacteria | 1684 |
| 108 | Ga0207708_10185345 | 3300026075 | Bacteria | 1654 |
| 109 | Ga0207641_10331215 | 3300026088 | Bacteria | 1446 |
| 110 | Ga0207641_10707517 | 3300026088 | Bacteria | 992 |
| 111 | Ga0207648_10012440 | 3300026089 | Bacteria | 7968 |
| 112 | Ga0207648_10221612 | 3300026089 | Bacteria | 1681 |
| 113 | Ga0207676_10009401 | 3300026095 | Bacteria | 6959 |
| 114 | Ga0207676_10021767 | 3300026095 | Bacteria | 4707 |
| 115 | Ga0207674_10619825 | 3300026116 | Bacteria | 1045 |
| 116 | Ga0207675_100001153 | 3300026118 | Bacteria | 26238 |
| 117 | Ga0207675_100001636 | 3300026118 | Bacteria | 22459 |
| 118 | Ga0207675_100029297 | 3300026118 | Bacteria | 5130 |
| 119 | Ga0207675_100067557 | 3300026118 | Bacteria | 3341 |
| 120 | Ga0207683_10006907 | 3300026121 | Bacteria | 9716 |
| 121 | Ga0207428_10257634 | 3300027907 | Bacteria | 1300 |
| 122 | Ga0268266_10073141 | 3300028379 | Bacteria | 2974 |
| 123 | Ga0268265_10016507 | 3300028380 | Bacteria | 5074 |
| 124 | Ga0268264_10032444 | 3300028381 | Bacteria | 4286 |
| 125 | Ga0307515_10242053 | 3300028794 | Bacteria | 1572 |
| 126 | Ga0307513_10021256 | 3300031456 | Bacteria | 7664 |
| 127 | Ga0307513_10053760 | 3300031456 | Bacteria | 4325 |
| 128 | Ga0307513_10069763 | 3300031456 | Bacteria | 3677 |
| 129 | Ga0307513_10075085 | 3300031456 | Bacteria | 3512 |
| 130 | Ga0307509_10162718 | 3300031507 | Bacteria | 2126 |
| 131 | Ga0307509_10297884 | 3300031507 | Bacteria | 1363 |
| 132 | Ga0307413_10001113 | 3300031824 | Bacteria | 9831 |
| 133 | Ga0307413_10020989 | 3300031824 | Bacteria | 3487 |
| 134 | Ga0307410_10024441 | 3300031852 | Bacteria | 3774 |
| 135 | Ga0307406_10068112 | 3300031901 | Bacteria | 2323 |
| 136 | Ga0307407_10030285 | 3300031903 | Bacteria | 2918 |
| 137 | Ga0307412_10294622 | 3300031911 | Bacteria | 1280 |
| 138 | Ga0307416_100140427 | 3300032002 | Bacteria | 2195 |
| 139 | Ga0307416_100447534 | 3300032002 | Bacteria | 1343 |
| 140 | Ga0307414_10323258 | 3300032004 | Bacteria | 1314 |
| 141 | Ga0307411_10092719 | 3300032005 | Bacteria | 2113 |
| 142 | Ga0307415_100135893 | 3300032126 | Bacteria | 1870 |
| 143 | Ga0316574_0149325 | 3300035398 | Bacteria | 1506 |
| 144 | Ga0316574_0186672 | 3300035398 | Bacteria | 1333 |
| 145 | Ga0373927_0343404 | 3300035695 | Bacteria | 984 |
| 146 | Ga0373933_0054216 | 3300035724 | Bacteria | 2403 |
| 147 | Ga0451787_692997 | 3300041441 | Bacteria | 1632 |
| 148 | Ga0451791_0018926 | 3300041451 | Bacteria | 3959 |
| 149 | Ga0451791_0251818 | 3300041451 | Bacteria | 1460 |
| 150 | Ga0451797_1116037 | 3300041453 | Bacteria | 1168 |
| 151 | Ga0451800_0307031 | 3300041459 | Bacteria | 1624 |
| 152 | Ga0451807_1721450 | 3300041486 | Bacteria | 1774 |
| 153 | Ga0451807_1912352 | 3300041486 | Bacteria | 1847 |
| 154 | Ga0451833_0496971 | 3300041491 | Bacteria | 2481 |
| 155 | Ga0451853_2615918 | 3300041512 | Bacteria | 1093 |
| 156 | Ga0450895_004212 | 3300042132 | Bacteria | 1131 |
| 157 | Ga0453684_0267755 | 3300044712 | Bacteria | 1954 |
| 158 | Ga0495590_0030590 | 3300046457 | Bacteria | 1886 |
| 159 | Ga0495638_0003097 | 3300046460 | Bacteria | 13188 |
| 160 | Ga0495638_0021454 | 3300046460 | Bacteria | 4257 |
| 161 | Ga0495584_0141444 | 3300046491 | Bacteria | 1222 |
| 162 | Ga0495594_0265811 | 3300046499 | Bacteria | 977 |
| 163 | Ga0495616_0080265 | 3300046513 | Bacteria | 1562 |
| 164 | Ga0495632_0068161 | 3300046519 | Bacteria | 1715 |
| 165 | Ga0495632_0130412 | 3300046519 | Bacteria | 1170 |
| 166 | Ga0495656_0023776 | 3300046615 | Bacteria | 2414 |
| 167 | Ga0495625_0042639 | 3300046660 | Bacteria | 3296 |
| 168 | Ga0495625_0043737 | 3300046660 | Bacteria | 3247 |
| 169 | Ga0495625_0186771 | 3300046660 | Bacteria | 1375 |
| 170 | Ga0495649_0106356 | 3300046694 | Bacteria | 1489 |
| 171 | Ga0495672_0013080 | 3300047320 | Bacteria | 5743 |
| 172 | Ga0495686_0272455 | 3300047472 | Bacteria | 943 |
| 173 | Ga0496104_0848472 | 3300048907 | Bacteria | 819 |
| 174 | Ga0501042_0051946 | 3300049578 | Bacteria | 2924 |
| 175 | Ga0501046_0070641 | 3300049580 | Bacteria | 2714 |
| 176 | Ga0501047_0002894 | 3300049581 | Bacteria | 16284 |
| 177 | Ga0501047_0549545 | 3300049581 | Bacteria | 979 |
| 178 | Ga0501070_0249395 | 3300049586 | Bacteria | 1452 |
| 179 | Ga0501071_0146495 | 3300049587 | Bacteria | 1760 |
| 180 | Ga0501073_0020089 | 3300049589 | Bacteria | 4816 |
| 181 | Ga0501074_0006860 | 3300049590 | Bacteria | 8224 |
| 182 | Ga0501075_0128334 | 3300049591 | Bacteria | 1931 |
| 183 | Ga0501076_0036591 | 3300049592 | Bacteria | 3846 |
| 184 | Ga0501077_0077523 | 3300049593 | Bacteria | 2105 |
| 185 | Ga0501079_0015170 | 3300049741 | Bacteria | 5875 |
| 186 | Ga0501080_0005108 | 3300049742 | Bacteria | 11690 |
| 187 | Ga0501080_0014601 | 3300049742 | Bacteria | 7235 |
| 188 | Ga0501083_0000842 | 3300049744 | Bacteria | 20163 |
| 189 | nmdc:mga08y16_145252_c1 | 3300050511 | Bacteria | 2466 |
| 190 | nmdc:mga08y16_265194_c1 | 3300050511 | Bacteria | 1773 |
| 191 | Ga0500568_0023236 | 3300053139 | Bacteria | 2639 |
| 192 | Ga0500622_0005990 | 3300053156 | Bacteria | 7146 |
| 193 | Ga0500611_033459 | 3300053727 | Bacteria | 1082 |
| 194 | Ga0501084_0314026 | 3300054114 | Bacteria | 1324 |
| 195 | Ga0501082_0018356 | 3300060353 | Bacteria | 6024 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048907 | Ga0496104_0848472 | Ga0496104_0848472_110_808 | 232 |
| 2 | 3300035398 | Ga0316574_0186672 | Ga0316574_0186672_450_1253 | 238 |
| 3 | 3300049578 | Ga0501042_0051946 | Ga0501042_0051946_1859_2653 | 238 |
| 4 | 3300035398 | Ga0316574_0149325 | Ga0316574_0149325_152_955 | 239 |
| 5 | 3300047472 | Ga0495686_0272455 | Ga0495686_0272455_208_930 | 240 |
| 6 | 3300005441 | Ga0070700_100056788 | Ga0070700_1000567882 | 242 |
| 7 | 3300005719 | Ga0068861_100000527 | Ga0068861_10000052714 | 242 |
| 8 | 3300026075 | Ga0207708_10054702 | Ga0207708_100547022 | 242 |
| 9 | 3300026118 | Ga0207675_100001636 | Ga0207675_1000016369 | 242 |
| 10 | 3300042132 | Ga0450895_004212 | Ga0450895_004212_390_1121 | 243 |
| 11 | 3300005337 | Ga0070682_100060454 | Ga0070682_1000604542 | 246 |
| 12 | 3300031911 | Ga0307412_10294622 | Ga0307412_102946222 | 246 |
| 13 | 3300046457 | Ga0495590_0030590 | Ga0495590_0030590_856_1653 | 246 |
| 14 | 3300046491 | Ga0495584_0141444 | Ga0495584_0141444_27_824 | 246 |
| 15 | 3300046519 | Ga0495632_0068161 | Ga0495632_0068161_474_1271 | 246 |
| 16 | 3300046660 | Ga0495625_0042639 | Ga0495625_0042639_1298_2095 | 246 |
| 17 | 3300005327 | Ga0070658_10461050 | Ga0070658_104610501 | 247 |
| 18 | 3300005337 | Ga0070682_100030109 | Ga0070682_1000301092 | 247 |
| 19 | 3300005937 | Ga0081455_10001291 | Ga0081455_1000129117 | 247 |
| 20 | 3300005719 | Ga0068861_100057683 | Ga0068861_1000576832 | 249 |
| 21 | 3300005844 | Ga0068862_100201214 | Ga0068862_1002012141 | 249 |
| 22 | 3300005328 | Ga0070676_10294534 | Ga0070676_102945342 | 250 |
| 23 | 3300005333 | Ga0070677_10091906 | Ga0070677_100919062 | 250 |
| 24 | 3300005353 | Ga0070669_100021427 | Ga0070669_1000214272 | 250 |
| 25 | 3300005354 | Ga0070675_100140424 | Ga0070675_1001404242 | 250 |
| 26 | 3300005354 | Ga0070675_100622142 | Ga0070675_1006221422 | 250 |
| 27 | 3300005356 | Ga0070674_100093434 | Ga0070674_1000934342 | 250 |
| 28 | 3300005364 | Ga0070673_100099586 | Ga0070673_1000995862 | 250 |
| 29 | 3300005441 | Ga0070700_100052951 | Ga0070700_1000529512 | 250 |
| 30 | 3300005456 | Ga0070678_100013132 | Ga0070678_1000131325 | 250 |
| 31 | 3300005543 | Ga0070672_100125975 | Ga0070672_1001259752 | 250 |
| 32 | 3300005543 | Ga0070672_100155871 | Ga0070672_1001558712 | 250 |
| 33 | 3300005564 | Ga0070664_100019524 | Ga0070664_1000195244 | 250 |
| 34 | 3300014325 | Ga0163163_10171164 | Ga0163163_101711642 | 250 |
| 35 | 3300014326 | Ga0157380_10079837 | Ga0157380_100798372 | 250 |
| 36 | 3300014326 | Ga0157380_10085584 | Ga0157380_100855842 | 250 |
| 37 | 3300025893 | Ga0207682_10028350 | Ga0207682_100283502 | 250 |
| 38 | 3300025923 | Ga0207681_10090207 | Ga0207681_100902072 | 250 |
| 39 | 3300025937 | Ga0207669_10117777 | Ga0207669_101177772 | 250 |
| 40 | 3300025940 | Ga0207691_10006675 | Ga0207691_100066755 | 250 |
| 41 | 3300025940 | Ga0207691_10272841 | Ga0207691_102728411 | 250 |
| 42 | 3300025940 | Ga0207691_10286177 | Ga0207691_102861772 | 250 |
| 43 | 3300025945 | Ga0207679_10020315 | Ga0207679_100203154 | 250 |
| 44 | 3300025960 | Ga0207651_10076166 | Ga0207651_100761662 | 250 |
| 45 | 3300026075 | Ga0207708_10013928 | Ga0207708_100139285 | 250 |
| 46 | 3300026089 | Ga0207648_10221612 | Ga0207648_102216122 | 250 |
| 47 | 3300026118 | Ga0207675_100067557 | Ga0207675_1000675572 | 250 |
| 48 | 3300026121 | Ga0207683_10006907 | Ga0207683_100069072 | 250 |
| 49 | 3300041441 | Ga0451787_692997 | Ga0451787_692997_629_1438 | 250 |
| 50 | 3300041451 | Ga0451791_0251818 | Ga0451791_0251818_378_1187 | 250 |
| 51 | 3300041459 | Ga0451800_0307031 | Ga0451800_0307031_530_1339 | 250 |
| 52 | 3300005330 | Ga0070690_100367620 | Ga0070690_1003676202 | 251 |
| 53 | 3300005331 | Ga0070670_100021687 | Ga0070670_1000216874 | 251 |
| 54 | 3300005333 | Ga0070677_10014936 | Ga0070677_100149362 | 251 |
| 55 | 3300005340 | Ga0070689_100008171 | Ga0070689_1000081711 | 251 |
| 56 | 3300005343 | Ga0070687_100119003 | Ga0070687_1001190032 | 251 |
| 57 | 3300005354 | Ga0070675_100336344 | Ga0070675_1003363442 | 251 |
| 58 | 3300005356 | Ga0070674_100361478 | Ga0070674_1003614781 | 251 |
| 59 | 3300005364 | Ga0070673_100392665 | Ga0070673_1003926652 | 251 |
| 60 | 3300005438 | Ga0070701_10025582 | Ga0070701_100255822 | 251 |
| 61 | 3300005438 | Ga0070701_10109899 | Ga0070701_101098991 | 251 |
| 62 | 3300005438 | Ga0070701_10184328 | Ga0070701_101843282 | 251 |
| 63 | 3300005441 | Ga0070700_100077177 | Ga0070700_1000771772 | 251 |
| 64 | 3300005466 | Ga0070685_10023767 | Ga0070685_100237673 | 251 |
| 65 | 3300005543 | Ga0070672_100106455 | Ga0070672_1001064552 | 251 |
| 66 | 3300005544 | Ga0070686_100147711 | Ga0070686_1001477112 | 251 |
| 67 | 3300005615 | Ga0070702_100092816 | Ga0070702_1000928162 | 251 |
| 68 | 3300005617 | Ga0068859_100028861 | Ga0068859_1000288613 | 251 |
| 69 | 3300005617 | Ga0068859_100168363 | Ga0068859_1001683632 | 251 |
| 70 | 3300005618 | Ga0068864_100012062 | Ga0068864_1000120623 | 251 |
| 71 | 3300005618 | Ga0068864_100642593 | Ga0068864_1006425931 | 251 |
| 72 | 3300005719 | Ga0068861_100096257 | Ga0068861_1000962572 | 251 |
| 73 | 3300005719 | Ga0068861_100161303 | Ga0068861_1001613032 | 251 |
| 74 | 3300005840 | Ga0068870_10004311 | Ga0068870_100043112 | 251 |
| 75 | 3300005841 | Ga0068863_100372907 | Ga0068863_1003729072 | 251 |
| 76 | 3300005844 | Ga0068862_100268119 | Ga0068862_1002681192 | 251 |
| 77 | 3300006881 | Ga0068865_100089323 | Ga0068865_1000893232 | 251 |
| 78 | 3300006931 | Ga0097620_100028861 | Ga0097620_1000288613 | 251 |
| 79 | 3300006931 | Ga0097620_100168356 | Ga0097620_1001683562 | 251 |
| 80 | 3300014325 | Ga0163163_10507758 | Ga0163163_105077582 | 251 |
| 81 | 3300014326 | Ga0157380_10249839 | Ga0157380_102498392 | 251 |
| 82 | 3300025893 | Ga0207682_10004656 | Ga0207682_100046566 | 251 |
| 83 | 3300025908 | Ga0207643_10008303 | Ga0207643_100083032 | 251 |
| 84 | 3300025936 | Ga0207670_10019714 | Ga0207670_100197144 | 251 |
| 85 | 3300025940 | Ga0207691_10009596 | Ga0207691_100095966 | 251 |
| 86 | 3300026075 | Ga0207708_10020362 | Ga0207708_100203623 | 251 |
| 87 | 3300026075 | Ga0207708_10178748 | Ga0207708_101787482 | 251 |
| 88 | 3300026088 | Ga0207641_10331215 | Ga0207641_103312152 | 251 |
| 89 | 3300026089 | Ga0207648_10012440 | Ga0207648_100124406 | 251 |
| 90 | 3300026095 | Ga0207676_10009401 | Ga0207676_100094014 | 251 |
| 91 | 3300026095 | Ga0207676_10021767 | Ga0207676_100217673 | 251 |
| 92 | 3300026118 | Ga0207675_100001153 | Ga0207675_10000115312 | 251 |
| 93 | 3300026118 | Ga0207675_100029297 | Ga0207675_1000292974 | 251 |
| 94 | 3300031456 | Ga0307513_10053760 | Ga0307513_100537602 | 251 |
| 95 | 3300032002 | Ga0307416_100447534 | Ga0307416_1004475342 | 251 |
| 96 | 3300046615 | Ga0495656_0023776 | Ga0495656_0023776_291_1085 | 251 |
| 97 | 3300005330 | Ga0070690_100004882 | Ga0070690_1000048822 | 252 |
| 98 | 3300005364 | Ga0070673_100023490 | Ga0070673_1000234903 | 252 |
| 99 | 3300005543 | Ga0070672_100071007 | Ga0070672_1000710072 | 252 |
| 100 | 3300005545 | Ga0070695_100065219 | Ga0070695_1000652192 | 252 |
| 101 | 3300005546 | Ga0070696_100064392 | Ga0070696_1000643922 | 252 |
| 102 | 3300013308 | Ga0157375_10045542 | Ga0157375_100455422 | 252 |
| 103 | 3300014326 | Ga0157380_10383042 | Ga0157380_103830422 | 252 |
| 104 | 3300025938 | Ga0207704_10332259 | Ga0207704_103322592 | 252 |
| 105 | 3300025940 | Ga0207691_10034105 | Ga0207691_100341052 | 252 |
| 106 | 3300025942 | Ga0207689_10193848 | Ga0207689_101938482 | 252 |
| 107 | 3300025960 | Ga0207651_10022523 | Ga0207651_100225232 | 252 |
| 108 | 3300026067 | Ga0207678_10112459 | Ga0207678_101124591 | 252 |
| 109 | 3300028794 | Ga0307515_10242053 | Ga0307515_102420532 | 252 |
| 110 | 3300031456 | Ga0307513_10075085 | Ga0307513_100750851 | 252 |
| 111 | 3300031507 | Ga0307509_10297884 | Ga0307509_102978842 | 252 |
| 112 | 3300031824 | Ga0307413_10020989 | Ga0307413_100209892 | 252 |
| 113 | 3300031901 | Ga0307406_10068112 | Ga0307406_100681122 | 252 |
| 114 | 3300041512 | Ga0451853_2615918 | Ga0451853_2615918_161_973 | 252 |
| 115 | 3300046519 | Ga0495632_0130412 | Ga0495632_0130412_215_1027 | 252 |
| 116 | 3300046660 | Ga0495625_0043737 | Ga0495625_0043737_1640_2434 | 252 |
| 117 | 3300046660 | Ga0495625_0186771 | Ga0495625_0186771_127_921 | 252 |
| 118 | 3300005337 | Ga0070682_100148022 | Ga0070682_1001480222 | 253 |
| 119 | 3300005577 | Ga0068857_100881064 | Ga0068857_1008810641 | 254 |
| 120 | 3300009094 | Ga0111539_10208527 | Ga0111539_102085272 | 254 |
| 121 | 3300050511 | nmdc:mga08y16_265194_c1 | nmdc:mga08y16_265194_c1_209_1018 | 254 |
| 122 | 3300025938 | Ga0207704_10351479 | Ga0207704_103514792 | 259 |
| 123 | 3300046694 | Ga0495649_0106356 | Ga0495649_0106356_523_1308 | 259 |
| 124 | 3300005577 | Ga0068857_100607284 | Ga0068857_1006072841 | 260 |
| 125 | 3300005843 | Ga0068860_100022011 | Ga0068860_1000220114 | 260 |
| 126 | 3300005844 | Ga0068862_100002808 | Ga0068862_10000280815 | 260 |
| 127 | 3300009551 | Ga0105238_10501675 | Ga0105238_105016752 | 260 |
| 128 | 3300009553 | Ga0105249_10655250 | Ga0105249_106552502 | 260 |
| 129 | 3300026116 | Ga0207674_10619825 | Ga0207674_106198251 | 260 |
| 130 | 3300028380 | Ga0268265_10016507 | Ga0268265_100165073 | 260 |
| 131 | 3300028381 | Ga0268264_10032444 | Ga0268264_100324443 | 260 |
| 132 | 3300035695 | Ga0373927_0343404 | Ga0373927_0343404_36_839 | 260 |
| 133 | 3300035724 | Ga0373933_0054216 | Ga0373933_0054216_1411_2214 | 260 |
| 134 | 3300046499 | Ga0495594_0265811 | Ga0495594_0265811_54_851 | 260 |
| 135 | 3300047320 | Ga0495672_0013080 | Ga0495672_0013080_4085_4867 | 260 |
| 136 | 3300049581 | Ga0501047_0002894 | Ga0501047_0002894_9783_10583 | 260 |
| 137 | 3300049742 | Ga0501080_0014601 | Ga0501080_0014601_5068_5865 | 260 |
| 138 | 3300049744 | Ga0501083_0000842 | Ga0501083_0000842_9332_10129 | 260 |
| 139 | 3300060353 | Ga0501082_0018356 | Ga0501082_0018356_4975_5772 | 260 |
| 140 | 3300044712 | Ga0453684_0267755 | Ga0453684_0267755_779_1573 | 261 |
| 141 | 3300003323 | rootH1_10226816 | rootH1_102268161 | 262 |
| 142 | 3300005328 | Ga0070676_10125119 | Ga0070676_101251192 | 262 |
| 143 | 3300005337 | Ga0070682_100132705 | Ga0070682_1001327052 | 262 |
| 144 | 3300005441 | Ga0070700_100360568 | Ga0070700_1003605681 | 262 |
| 145 | 3300005466 | Ga0070685_10130075 | Ga0070685_101300752 | 262 |
| 146 | 3300005548 | Ga0070665_100006995 | Ga0070665_1000069957 | 262 |
| 147 | 3300005548 | Ga0070665_100026513 | Ga0070665_1000265132 | 262 |
| 148 | 3300005719 | Ga0068861_100190980 | Ga0068861_1001909802 | 262 |
| 149 | 3300005719 | Ga0068861_100405047 | Ga0068861_1004050472 | 262 |
| 150 | 3300005841 | Ga0068863_100634900 | Ga0068863_1006349002 | 262 |
| 151 | 3300006237 | Ga0097621_100043205 | Ga0097621_1000432052 | 262 |
| 152 | 3300006358 | Ga0068871_100214584 | Ga0068871_1002145842 | 262 |
| 153 | 3300006881 | Ga0068865_100610064 | Ga0068865_1006100642 | 262 |
| 154 | 3300009094 | Ga0111539_10014520 | Ga0111539_100145205 | 262 |
| 155 | 3300013306 | Ga0163162_10228824 | Ga0163162_102288241 | 262 |
| 156 | 3300014969 | Ga0157376_10607210 | Ga0157376_106072102 | 262 |
| 157 | 3300025945 | Ga0207679_10477939 | Ga0207679_104779392 | 262 |
| 158 | 3300026075 | Ga0207708_10185345 | Ga0207708_101853452 | 262 |
| 159 | 3300026088 | Ga0207641_10707517 | Ga0207641_107075171 | 262 |
| 160 | 3300027907 | Ga0207428_10257634 | Ga0207428_102576342 | 262 |
| 161 | 3300028379 | Ga0268266_10073141 | Ga0268266_100731412 | 262 |
| 162 | 3300031456 | Ga0307513_10021256 | Ga0307513_100212562 | 262 |
| 163 | 3300031456 | Ga0307513_10069763 | Ga0307513_100697633 | 262 |
| 164 | 3300031507 | Ga0307509_10162718 | Ga0307509_101627182 | 262 |
| 165 | 3300031824 | Ga0307413_10001113 | Ga0307413_100011133 | 262 |
| 166 | 3300031852 | Ga0307410_10024441 | Ga0307410_100244413 | 262 |
| 167 | 3300031903 | Ga0307407_10030285 | Ga0307407_100302853 | 262 |
| 168 | 3300032002 | Ga0307416_100140427 | Ga0307416_1001404272 | 262 |
| 169 | 3300032004 | Ga0307414_10323258 | Ga0307414_103232582 | 262 |
| 170 | 3300032005 | Ga0307411_10092719 | Ga0307411_100927192 | 262 |
| 171 | 3300032126 | Ga0307415_100135893 | Ga0307415_1001358932 | 262 |
| 172 | 3300041451 | Ga0451791_0018926 | Ga0451791_0018926_884_1681 | 262 |
| 173 | 3300041453 | Ga0451797_1116037 | Ga0451797_1116037_251_1048 | 262 |
| 174 | 3300041486 | Ga0451807_1721450 | Ga0451807_1721450_483_1280 | 262 |
| 175 | 3300041486 | Ga0451807_1912352 | Ga0451807_1912352_669_1463 | 262 |
| 176 | 3300041491 | Ga0451833_0496971 | Ga0451833_0496971_1472_2269 | 262 |
| 177 | 3300046460 | Ga0495638_0003097 | Ga0495638_0003097_201_995 | 262 |
| 178 | 3300046460 | Ga0495638_0021454 | Ga0495638_0021454_1111_1905 | 262 |
| 179 | 3300046513 | Ga0495616_0080265 | Ga0495616_0080265_452_1246 | 262 |
| 180 | 3300049580 | Ga0501046_0070641 | Ga0501046_0070641_658_1446 | 262 |
| 181 | 3300049581 | Ga0501047_0549545 | Ga0501047_0549545_35_823 | 262 |
| 182 | 3300049586 | Ga0501070_0249395 | Ga0501070_0249395_473_1267 | 262 |
| 183 | 3300049587 | Ga0501071_0146495 | Ga0501071_0146495_874_1668 | 262 |
| 184 | 3300049589 | Ga0501073_0020089 | Ga0501073_0020089_2833_3627 | 262 |
| 185 | 3300049590 | Ga0501074_0006860 | Ga0501074_0006860_3044_3838 | 262 |
| 186 | 3300049591 | Ga0501075_0128334 | Ga0501075_0128334_267_1061 | 262 |
| 187 | 3300049592 | Ga0501076_0036591 | Ga0501076_0036591_2522_3316 | 262 |
| 188 | 3300049593 | Ga0501077_0077523 | Ga0501077_0077523_833_1627 | 262 |
| 189 | 3300049741 | Ga0501079_0015170 | Ga0501079_0015170_3481_4275 | 262 |
| 190 | 3300049742 | Ga0501080_0005108 | Ga0501080_0005108_3944_4738 | 262 |
| 191 | 3300050511 | nmdc:mga08y16_145252_c1 | nmdc:mga08y16_145252_c1_736_1530 | 262 |
| 192 | 3300053139 | Ga0500568_0023236 | Ga0500568_0023236_482_1270 | 262 |
| 193 | 3300053156 | Ga0500622_0005990 | Ga0500622_0005990_1846_2634 | 262 |
| 194 | 3300053727 | Ga0500611_033459 | Ga0500611_033459_80_874 | 262 |
| 195 | 3300054114 | Ga0501084_0314026 | Ga0501084_0314026_49_843 | 262 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lk5-assembly1.cif.gz_B | crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 | 0.9452 | 3 | 255 |
| 6lvo-assembly1.cif.gz_A | enoyl-coa isomerase (boeci) from bosea sp. pamc 26642 | 0.9404 | 3 | 251 |
| 3pea-assembly2.cif.gz_F | crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' | 0.9379 | 3 | 260 |
| 3pea-assembly2.cif.gz_D | crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' | 0.9365 | 3 | 260 |
| 4knp-assembly1.cif.gz_A | crystal structure of a putative enoyl-coa hydratase (psi-nysgrc-019597) from mycobacterium avium paratuberculosis k-10 | 0.9348 | 4 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3i47A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9733 | 1 | 202 | 3.90.226.10 |
| 3mybC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9678 | 3 | 202 | 3.90.226.10 |
| 3i47A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9639 | 1 | 202 | 3.90.226.10 |
| 3mybC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9537 | 3 | 202 | 3.90.226.10 |
| 1uiyA01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9505 | 4 | 202 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F4DU87-F1-model_v4 | Enoyl-CoA hydratase | 0.9918 | 3 | 181 |
GO:0003824
GO:0008300 |
| AF-A0A6L7ZWB8-F1-model_v4 | Enoyl-CoA hydratase | 0.9914 | 1 | 197 |
GO:0008300
|
| AF-A0A537VV39-F1-model_v4 | Enoyl-CoA hydratase | 0.9896 | 2 | 173 |
GO:0008300
|
| AF-A0A3S1LET7-F1-model_v4 | deleted | 0.9885 | 3 | 183 |
|
| AF-A0A536URT3-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein (EC 4.2.1.17) | 0.9881 | 5 | 198 |
GO:0004300
GO:0008300 GO:0016853 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar