F300037

General Info

Members Datasets Scaffolds Average Seq Length
195 149 195 126

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10328813|Ga0105241_103288132
Length 148
Sequence MRAILARKLVRDREPRQKAGGAMALIHTCYRITDIDRSVEFYEALGFKEVGRVPIRDEAVNVFMSQPGDGDSPRLELTYNFGVDHYELGTGYGHIAITAPDLDATLAKLAEQGIEPERPPYSIREGGSRLCFVRDPDGYRIEILEMAV

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
14 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
15 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
55 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
56 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
57 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
58 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.62
Rhizosphere 91.28
Stem 0
Stem Tuber 0
Unclassified 4.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10494699 3300005327 Bacteria 1056
2 Ga0070683_100034448 3300005329 Bacteria 4626
3 Ga0070666_10580861 3300005335 Bacteria 817
4 Ga0070660_100007388 3300005339 Bacteria 7655
5 Ga0070660_100100594 3300005339 Bacteria 2290
6 Ga0070671_100302035 3300005355 Bacteria 1363
7 Ga0070714_100835275 3300005435 Bacteria 893
8 Ga0070714_100840692 3300005435 Bacteria 890
9 Ga0070714_101807583 3300005435 Bacteria 597
10 Ga0070713_100427903 3300005436 Bacteria 1240
11 Ga0070711_100000326 3300005439 Bacteria 24637
12 Ga0070679_100214196 3300005530 Bacteria 1889
13 Ga0068856_100107913 3300005614 Bacteria 2780
14 Ga0068856_101371560 3300005614 Bacteria 722
15 Ga0068870_10180456 3300005840 Bacteria 1267
16 Ga0081455_10666253 3300005937 Bacteria 668
17 Ga0070715_10463395 3300006163 Bacteria 718
18 Ga0070716_100369226 3300006173 Bacteria 1022
19 Ga0070712_100000005 3300006175 Bacteria 177449
20 Ga0070712_101491638 3300006175 Unclassified 591
21 Ga0070712_101559102 3300006175 Bacteria 578
22 Ga0075428_100064737 3300006844 Bacteria 4004
23 Ga0075430_100002607 3300006846 Bacteria 15053
24 Ga0075431_100735739 3300006847 Bacteria 962
25 Ga0075434_100732208 3300006871 Bacteria 1006
26 Ga0075436_100233980 3300006914 Bacteria 1305
27 Ga0075435_100115738 3300007076 Bacteria 2233
28 Ga0075435_100972913 3300007076 Bacteria 741
29 Ga0111539_10320235 3300009094 Bacteria 1805
30 Ga0105245_10769433 3300009098 Bacteria 999
31 Ga0105245_10962777 3300009098 Bacteria 897
32 Ga0105245_11538550 3300009098 Bacteria 716
33 Ga0114129_10276244 3300009147 Bacteria 2246
34 Ga0105241_10328813 3300009174 Bacteria 1320
35 Ga0105242_12250064 3300009176 Unclassified 591
36 Ga0105237_10000431 3300009545 Bacteria 59607
37 Ga0105238_10302346 3300009551 Bacteria 1583
38 Ga0105239_10208918 3300010375 Bacteria 2188
39 Ga0105246_10014081 3300011119 Bacteria 5025
40 Ga0157374_10942759 3300013296 Bacteria 881
41 Ga0157378_12471052 3300013297 Unclassified 571
42 Ga0163162_10125381 3300013306 Bacteria 2674
43 Ga0157372_10220124 3300013307 Unclassified 2200
44 Ga0157380_10485305 3300014326 Bacteria 1196
45 Ga0163161_10295716 3300017792 Bacteria 1274
46 Ga0207699_10994140 3300025906 Bacteria 620
47 Ga0207705_10187632 3300025909 Bacteria 1562
48 Ga0207654_10284200 3300025911 Bacteria 1120
49 Ga0207671_10012708 3300025914 Bacteria 6753
50 Ga0207693_10000023 3300025915 Bacteria 127876
51 Ga0207663_10000379 3300025916 Bacteria 19428
52 Ga0207657_10026415 3300025919 Bacteria 5338
53 Ga0207657_10106853 3300025919 Bacteria 2315
54 Ga0207649_10662277 3300025920 Bacteria 807
55 Ga0207649_11239620 3300025920 Bacteria 590
56 Ga0207687_10180416 3300025927 Bacteria 1635
57 Ga0207664_10701789 3300025929 Bacteria 910
58 Ga0207665_10101858 3300025939 Unclassified 2006
59 Ga0207665_11521220 3300025939 Bacteria 532
60 Ga0207661_10490400 3300025944 Bacteria 1122
61 Ga0207712_10907567 3300025961 Bacteria 779
62 Ga0207678_10916845 3300026067 Bacteria 775
63 Ga0207702_10082708 3300026078 Bacteria 2792
64 Ga0207702_11037256 3300026078 Bacteria 814
65 Ga0207675_100258986 3300026118 Bacteria 1685
66 Ga0207428_10377989 3300027907 Bacteria 1040
67 Ga0265326_10001220 3300028558 Bacteria 9196
68 Ga0265319_1000065 3300028563 Bacteria 85273
69 Ga0265319_1032747 3300028563 Bacteria 1799
70 Ga0265318_10002902 3300028577 Bacteria 8913
71 Ga0265318_10002949 3300028577 Bacteria 8823
72 Ga0265322_10006887 3300028654 Unclassified 3330
73 Ga0265322_10043015 3300028654 Bacteria 1286
74 Ga0265336_10000001 3300028666 Bacteria 916179
75 Ga0265338_10000004 3300028800 Bacteria 644793
76 Ga0265338_10061189 3300028800 Bacteria 3301
77 Ga0265324_10006168 3300029957 Bacteria 5051
78 Ga0265320_10050996 3300031240 Bacteria 2009
79 Ga0265340_10000002 3300031247 Bacteria 711693
80 Ga0265339_10304363 3300031249 Bacteria 759
81 Ga0265316_10018029 3300031344 Bacteria 6081
82 Ga0265313_10075528 3300031595 Bacteria 1542
83 Ga0265342_10166040 3300031712 Bacteria 1217
84 Ga0307416_102792902 3300032002 Bacteria 584
85 Ga0373946_0276471 3300035171 Bacteria 825
86 Ga0373937_2027140 3300036401 Bacteria 521
87 Ga0395899_0009929 3300037312 Bacteria 7300
88 Ga0395900_0111794 3300037418 Bacteria 2805
89 Ga0395898_0008519 3300037466 Bacteria 10836
90 Ga0395905_0100329 3300037471 Bacteria 2718
91 Ga0436364_0009793 3300037853 Bacteria 739
92 Ga0436364_0814519 3300037853 Bacteria 568
93 Ga0436364_1424815 3300037853 Bacteria 2230
94 Ga0395901_0011570 3300038443 Bacteria 8941
95 Ga0436365_0016017 3300039437 Bacteria 1754
96 Ga0436365_1579076 3300039437 Bacteria 2666
97 Ga0436365_1605782 3300039437 Bacteria 1218
98 Ga0436363_0241122 3300039450 Bacteria 1032
99 Ga0436363_0570320 3300039450 Bacteria 627
100 Ga0466969_0224345 3300044656 Bacteria 854
101 Ga0466965_0193643 3300044683 Bacteria 1076
102 Ga0466965_0349343 3300044683 Unclassified 810
103 Ga0466966_0020060 3300044684 Bacteria 4398
104 Ga0466966_0341421 3300044684 Bacteria 900
105 Ga0466961_0008909 3300044693 Bacteria 6401
106 Ga0466961_0029495 3300044693 Bacteria 3526
107 Ga0466963_0085843 3300044694 Bacteria 2137
108 Ga0466963_1203213 3300044694 Bacteria 532
109 Ga0466964_0119629 3300044706 Bacteria 1186
110 Ga0466971_0000736 3300044719 Bacteria 13117
111 Ga0466971_0051346 3300044719 Bacteria 1856
112 Ga0466968_0024446 3300044735 Bacteria 2468
113 Ga0466968_0289387 3300044735 Bacteria 786
114 Ga0466970_0333638 3300044765 Bacteria 859
115 Ga0466957_0009098 3300044842 Bacteria 5662
116 Ga0466957_0206958 3300044842 Bacteria 1291
117 Ga0466957_0531561 3300044842 Bacteria 818
118 Ga0466960_0006931 3300044901 Bacteria 4571
119 Ga0466959_0002472 3300045049 Bacteria 11831
120 Ga0466959_0069114 3300045049 Bacteria 2559
121 Ga0466959_0166868 3300045049 Bacteria 1546
122 Ga0466959_0259008 3300045049 Bacteria 1198
123 Ga0466959_0298660 3300045049 Bacteria 1103
124 Ga0466959_0338388 3300045049 Bacteria 1027
125 Ga0466959_0644060 3300045049 Bacteria 712
126 Ga0466958_0001867 3300045836 Bacteria 10290
127 Ga0466958_0033770 3300045836 Bacteria 3049
128 Ga0466958_0320014 3300045836 Bacteria 997
129 Ga0466967_0170608 3300045976 Bacteria 2047
130 Ga0466967_0991914 3300045976 Bacteria 836
131 Ga0495629_0682581 3300046459 Bacteria 683
132 Ga0495653_0000907 3300046463 Bacteria 22917
133 Ga0495664_0000036 3300046477 Bacteria 71543
134 Ga0495635_0655208 3300046663 Bacteria 683
135 Ga0495588_0087584 3300046674 Bacteria 1629
136 Ga0495646_0143863 3300046680 Bacteria 1331
137 Ga0495647_0088584 3300046681 Bacteria 1265
138 Ga0495658_0050219 3300046683 Bacteria 2359
139 Ga0495624_0647003 3300046690 Bacteria 629
140 Ga0495581_0692629 3300047315 Bacteria 588
141 Ga0495604_0000996 3300047317 Bacteria 23554
142 Ga0495674_0231528 3300047319 Bacteria 1525
143 Ga0495674_1246989 3300047319 Bacteria 560
144 Ga0495676_0062386 3300047321 Bacteria 2910
145 Ga0495684_0001810 3300047471 Bacteria 17176
146 Ga0496100_0630782 3300048903 Unclassified 834
147 Ga0496102_0297988 3300048905 Bacteria 1520
148 Ga0496103_0515644 3300048906 Bacteria 764
149 Ga0496103_0743750 3300048906 Bacteria 620
150 Ga0496105_0589963 3300048908 Bacteria 863
151 Ga0496107_1023664 3300048910 Bacteria 599
152 Ga0496110_1261072 3300048913 Bacteria 648
153 Ga0496112_0009084 3300048915 Bacteria 8930
154 Ga0496115_1237540 3300048918 Bacteria 559
155 Ga0501031_0030211 3300049568 Bacteria 3534
156 Ga0501033_1129345 3300049570 Bacteria 520
157 Ga0501036_0170743 3300049572 Bacteria 1832
158 Ga0501038_0169072 3300049574 Bacteria 1771
159 Ga0501039_0021624 3300049575 Bacteria 4935
160 Ga0501039_0245142 3300049575 Bacteria 1409
161 Ga0501040_0033535 3300049576 Bacteria 3478
162 Ga0501041_0036935 3300049577 Bacteria 2959
163 Ga0501042_0054544 3300049578 Bacteria 2851
164 Ga0501048_0014232 3300049582 Bacteria 5892
165 Ga0501068_0129336 3300049584 Bacteria 1578
166 Ga0501070_0455335 3300049586 Bacteria 1031
167 Ga0501071_0013896 3300049587 Bacteria 5497
168 Ga0501072_0005900 3300049588 Bacteria 9331
169 Ga0501072_0078364 3300049588 Bacteria 2616
170 Ga0501074_0059778 3300049590 Bacteria 2745
171 Ga0501075_0048182 3300049591 Bacteria 3202
172 Ga0501076_0004159 3300049592 Bacteria 10239
173 Ga0501077_0028114 3300049593 Bacteria 3573
174 Ga0501079_0210782 3300049741 Bacteria 1517
175 Ga0501080_0773321 3300049742 Bacteria 843
176 Ga0501081_0027343 3300049743 Bacteria 3848
177 Ga0501083_0275404 3300049744 Bacteria 1095
178 Ga0501035_0047089 3300049822 Bacteria 3873
179 Ga0501045_0006706 3300049824 Bacteria 7977
180 nmdc:mga05p37_1021488_c1 3300050507 Bacteria 876
181 nmdc:mga0qj67_11303_c1 3300050509 Bacteria 6687
182 nmdc:mga06r32_498194_c1 3300050510 Bacteria 1195
183 nmdc:mga08y16_64177_c1 3300050511 Bacteria 3835
184 nmdc:mga0n895_346471_c1 3300050512 Bacteria 1505
185 nmdc:mga0n895_657609_c1 3300050512 Bacteria 1046
186 nmdc:mga0rr50_34321_c1 3300050513 Bacteria 3632
187 nmdc:mga0a205_109833_c1 3300050515 Bacteria 2656
188 nmdc:mga0a205_1389133_c1 3300050515 Bacteria 550
189 Ga0495601_0004765 3300053077 Bacteria 7868
190 Ga0495601_0066889 3300053077 Bacteria 2288
191 Ga0495619_0932075 3300053085 Bacteria 583
192 Ga0501084_0191721 3300054114 Bacteria 1724
193 Ga0501082_0036548 3300060353 Bacteria 4231
194 Ga0466962_0010582 3300061719 Bacteria 4436
195 Ga0530510_0001964 3300061734 Bacteria 14078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044706 Ga0466964_0119629 Ga0466964_0119629_688_1062 120
2 3300005436 Ga0070713_100427903 Ga0070713_1004279032 122
3 3300005614 Ga0068856_100107913 Ga0068856_1001079132 122
4 3300009098 Ga0105245_10962777 Ga0105245_109627772 122
5 3300025920 Ga0207649_10662277 Ga0207649_106622772 122
6 3300026078 Ga0207702_10082708 Ga0207702_100827082 122
7 3300039450 Ga0436363_0570320 Ga0436363_0570320_155_535 122
8 3300044735 Ga0466968_0289387 Ga0466968_0289387_254_631 122
9 3300044765 Ga0466970_0333638 Ga0466970_0333638_60_437 122
10 3300044842 Ga0466957_0531561 Ga0466957_0531561_390_767 122
11 3300045049 Ga0466959_0298660 Ga0466959_0298660_188_565 122
12 3300045049 Ga0466959_0644060 Ga0466959_0644060_316_693 122
13 3300045836 Ga0466958_0320014 Ga0466958_0320014_280_657 122
14 3300045976 Ga0466967_0170608 Ga0466967_0170608_196_576 122
15 3300005435 Ga0070714_100840692 Ga0070714_1008406922 123
16 3300005439 Ga0070711_100000326 Ga0070711_10000032621 123
17 3300005937 Ga0081455_10666253 Ga0081455_106662531 123
18 3300006173 Ga0070716_100369226 Ga0070716_1003692262 123
19 3300006846 Ga0075430_100002607 Ga0075430_10000260720 123
20 3300009545 Ga0105237_10000431 Ga0105237_100004318 123
21 3300010375 Ga0105239_10208918 Ga0105239_102089183 123
22 3300013307 Ga0157372_10220124 Ga0157372_102201244 123
23 3300017792 Ga0163161_10295716 Ga0163161_102957161 123
24 3300025914 Ga0207671_10012708 Ga0207671_100127088 123
25 3300025916 Ga0207663_10000379 Ga0207663_1000037921 123
26 3300025929 Ga0207664_10701789 Ga0207664_107017892 123
27 3300032002 Ga0307416_102792902 Ga0307416_1027929021 123
28 3300036401 Ga0373937_2027140 Ga0373937_2027140_32_409 123
29 3300037312 Ga0395899_0009929 Ga0395899_0009929_479_850 123
30 3300037418 Ga0395900_0111794 Ga0395900_0111794_1375_1746 123
31 3300037466 Ga0395898_0008519 Ga0395898_0008519_4759_5130 123
32 3300037471 Ga0395905_0100329 Ga0395905_0100329_1548_1919 123
33 3300037853 Ga0436364_0009793 Ga0436364_0009793_79_459 123
34 3300037853 Ga0436364_1424815 Ga0436364_1424815_773_1153 123
35 3300038443 Ga0395901_0011570 Ga0395901_0011570_591_962 123
36 3300039437 Ga0436365_0016017 Ga0436365_0016017_981_1361 123
37 3300039437 Ga0436365_1579076 Ga0436365_1579076_143_523 123
38 3300039450 Ga0436363_0241122 Ga0436363_0241122_438_818 123
39 3300044656 Ga0466969_0224345 Ga0466969_0224345_142_519 123
40 3300044683 Ga0466965_0193643 Ga0466965_0193643_446_823 123
41 3300044683 Ga0466965_0349343 Ga0466965_0349343_116_493 123
42 3300044684 Ga0466966_0020060 Ga0466966_0020060_230_607 123
43 3300044684 Ga0466966_0341421 Ga0466966_0341421_244_621 123
44 3300044693 Ga0466961_0008909 Ga0466961_0008909_4288_4665 123
45 3300044693 Ga0466961_0029495 Ga0466961_0029495_47_424 123
46 3300044694 Ga0466963_0085843 Ga0466963_0085843_1733_2110 123
47 3300044719 Ga0466971_0000736 Ga0466971_0000736_8373_8750 123
48 3300044719 Ga0466971_0051346 Ga0466971_0051346_1448_1828 123
49 3300044842 Ga0466957_0009098 Ga0466957_0009098_2946_3323 123
50 3300045049 Ga0466959_0002472 Ga0466959_0002472_9249_9626 123
51 3300045049 Ga0466959_0069114 Ga0466959_0069114_1660_2037 123
52 3300045049 Ga0466959_0166868 Ga0466959_0166868_1116_1493 123
53 3300045049 Ga0466959_0259008 Ga0466959_0259008_483_860 123
54 3300045836 Ga0466958_0001867 Ga0466958_0001867_7932_8309 123
55 3300045976 Ga0466967_0991914 Ga0466967_0991914_424_804 123
56 3300046477 Ga0495664_0000036 Ga0495664_0000036_70813_71190 123
57 3300046663 Ga0495635_0655208 Ga0495635_0655208_98_475 123
58 3300046680 Ga0495646_0143863 Ga0495646_0143863_249_626 123
59 3300047319 Ga0495674_1246989 Ga0495674_1246989_20_397 123
60 3300048906 Ga0496103_0515644 Ga0496103_0515644_91_468 123
61 3300048918 Ga0496115_1237540 Ga0496115_1237540_96_476 123
62 3300049568 Ga0501031_0030211 Ga0501031_0030211_1366_1737 123
63 3300049570 Ga0501033_1129345 Ga0501033_1129345_37_408 123
64 3300049572 Ga0501036_0170743 Ga0501036_0170743_543_914 123
65 3300049574 Ga0501038_0169072 Ga0501038_0169072_1147_1518 123
66 3300049575 Ga0501039_0021624 Ga0501039_0021624_2453_2824 123
67 3300049576 Ga0501040_0033535 Ga0501040_0033535_586_957 123
68 3300049577 Ga0501041_0036935 Ga0501041_0036935_798_1169 123
69 3300049578 Ga0501042_0054544 Ga0501042_0054544_2418_2789 123
70 3300049582 Ga0501048_0014232 Ga0501048_0014232_2437_2808 123
71 3300049584 Ga0501068_0129336 Ga0501068_0129336_914_1285 123
72 3300049586 Ga0501070_0455335 Ga0501070_0455335_434_805 123
73 3300049587 Ga0501071_0013896 Ga0501071_0013896_4048_4419 123
74 3300049588 Ga0501072_0005900 Ga0501072_0005900_5672_6043 123
75 3300049590 Ga0501074_0059778 Ga0501074_0059778_1384_1755 123
76 3300049591 Ga0501075_0048182 Ga0501075_0048182_2418_2789 123
77 3300049592 Ga0501076_0004159 Ga0501076_0004159_5804_6175 123
78 3300049593 Ga0501077_0028114 Ga0501077_0028114_2525_2896 123
79 3300049741 Ga0501079_0210782 Ga0501079_0210782_218_589 123
80 3300049742 Ga0501080_0773321 Ga0501080_0773321_405_776 123
81 3300049743 Ga0501081_0027343 Ga0501081_0027343_981_1352 123
82 3300049744 Ga0501083_0275404 Ga0501083_0275404_448_819 123
83 3300049822 Ga0501035_0047089 Ga0501035_0047089_3271_3642 123
84 3300049824 Ga0501045_0006706 Ga0501045_0006706_2334_2705 123
85 3300050509 nmdc:mga0qj67_11303_c1 nmdc:mga0qj67_11303_c1_2739_3110 123
86 3300053085 Ga0495619_0932075 Ga0495619_0932075_187_564 123
87 3300054114 Ga0501084_0191721 Ga0501084_0191721_1172_1543 123
88 3300060353 Ga0501082_0036548 Ga0501082_0036548_741_1112 123
89 3300061719 Ga0466962_0010582 Ga0466962_0010582_3810_4187 123
90 3300061734 Ga0530510_0001964 Ga0530510_0001964_2936_3307 123
91 3300005329 Ga0070683_100034448 Ga0070683_1000344483 124
92 3300005339 Ga0070660_100100594 Ga0070660_1001005943 124
93 3300005355 Ga0070671_100302035 Ga0070671_1003020353 124
94 3300005435 Ga0070714_101807583 Ga0070714_1018075831 124
95 3300005530 Ga0070679_100214196 Ga0070679_1002141962 124
96 3300005614 Ga0068856_101371560 Ga0068856_1013715602 124
97 3300005840 Ga0068870_10180456 Ga0068870_101804562 124
98 3300006163 Ga0070715_10463395 Ga0070715_104633951 124
99 3300006175 Ga0070712_100000005 Ga0070712_10000000598 124
100 3300006175 Ga0070712_101491638 Ga0070712_1014916381 124
101 3300006175 Ga0070712_101559102 Ga0070712_1015591021 124
102 3300006844 Ga0075428_100064737 Ga0075428_1000647373 124
103 3300006847 Ga0075431_100735739 Ga0075431_1007357392 124
104 3300007076 Ga0075435_100115738 Ga0075435_1001157382 124
105 3300007076 Ga0075435_100972913 Ga0075435_1009729132 124
106 3300009094 Ga0111539_10320235 Ga0111539_103202352 124
107 3300009098 Ga0105245_10769433 Ga0105245_107694332 124
108 3300009098 Ga0105245_11538550 Ga0105245_115385502 124
109 3300009147 Ga0114129_10276244 Ga0114129_102762442 124
110 3300009176 Ga0105242_12250064 Ga0105242_122500641 124
111 3300009551 Ga0105238_10302346 Ga0105238_103023463 124
112 3300011119 Ga0105246_10014081 Ga0105246_100140813 124
113 3300013296 Ga0157374_10942759 Ga0157374_109427592 124
114 3300013297 Ga0157378_12471052 Ga0157378_124710522 124
115 3300025906 Ga0207699_10994140 Ga0207699_109941401 124
116 3300025911 Ga0207654_10284200 Ga0207654_102842002 124
117 3300025915 Ga0207693_10000023 Ga0207693_1000002376 124
118 3300025919 Ga0207657_10106853 Ga0207657_101068532 124
119 3300025920 Ga0207649_11239620 Ga0207649_112396201 124
120 3300025927 Ga0207687_10180416 Ga0207687_101804163 124
121 3300025939 Ga0207665_10101858 Ga0207665_101018583 124
122 3300025939 Ga0207665_11521220 Ga0207665_115212201 124
123 3300025944 Ga0207661_10490400 Ga0207661_104904002 124
124 3300026067 Ga0207678_10916845 Ga0207678_109168452 124
125 3300026078 Ga0207702_11037256 Ga0207702_110372562 124
126 3300028558 Ga0265326_10001220 Ga0265326_100012209 124
127 3300028563 Ga0265319_1000065 Ga0265319_100006547 124
128 3300028563 Ga0265319_1032747 Ga0265319_10327473 124
129 3300028577 Ga0265318_10002902 Ga0265318_100029029 124
130 3300028577 Ga0265318_10002949 Ga0265318_100029494 124
131 3300028654 Ga0265322_10006887 Ga0265322_100068876 124
132 3300028654 Ga0265322_10043015 Ga0265322_100430152 124
133 3300028666 Ga0265336_10000001 Ga0265336_10000001364 124
134 3300028800 Ga0265338_10000004 Ga0265338_10000004518 124
135 3300028800 Ga0265338_10061189 Ga0265338_100611892 124
136 3300029957 Ga0265324_10006168 Ga0265324_100061685 124
137 3300031240 Ga0265320_10050996 Ga0265320_100509962 124
138 3300031247 Ga0265340_10000002 Ga0265340_10000002518 124
139 3300031249 Ga0265339_10304363 Ga0265339_103043632 124
140 3300031344 Ga0265316_10018029 Ga0265316_100180292 124
141 3300031595 Ga0265313_10075528 Ga0265313_100755283 124
142 3300031712 Ga0265342_10166040 Ga0265342_101660402 124
143 3300035171 Ga0373946_0276471 Ga0373946_0276471_76_456 124
144 3300037853 Ga0436364_0814519 Ga0436364_0814519_87_473 124
145 3300044694 Ga0466963_1203213 Ga0466963_1203213_45_428 124
146 3300044735 Ga0466968_0024446 Ga0466968_0024446_1932_2315 124
147 3300045049 Ga0466959_0338388 Ga0466959_0338388_242_625 124
148 3300045836 Ga0466958_0033770 Ga0466958_0033770_997_1380 124
149 3300046463 Ga0495653_0000907 Ga0495653_0000907_5321_5719 124
150 3300046674 Ga0495588_0087584 Ga0495588_0087584_541_921 124
151 3300046681 Ga0495647_0088584 Ga0495647_0088584_379_759 124
152 3300046690 Ga0495624_0647003 Ga0495624_0647003_169_549 124
153 3300047315 Ga0495581_0692629 Ga0495581_0692629_180_560 124
154 3300047317 Ga0495604_0000996 Ga0495604_0000996_8890_9273 124
155 3300047319 Ga0495674_0231528 Ga0495674_0231528_634_1026 124
156 3300047321 Ga0495676_0062386 Ga0495676_0062386_1192_1572 124
157 3300047471 Ga0495684_0001810 Ga0495684_0001810_14302_14682 124
158 3300048903 Ga0496100_0630782 Ga0496100_0630782_165_545 124
159 3300048905 Ga0496102_0297988 Ga0496102_0297988_128_502 124
160 3300048906 Ga0496103_0743750 Ga0496103_0743750_61_435 124
161 3300048908 Ga0496105_0589963 Ga0496105_0589963_165_548 124
162 3300048910 Ga0496107_1023664 Ga0496107_1023664_77_457 124
163 3300048913 Ga0496110_1261072 Ga0496110_1261072_87_461 124
164 3300048915 Ga0496112_0009084 Ga0496112_0009084_774_1157 124
165 3300049575 Ga0501039_0245142 Ga0501039_0245142_268_645 124
166 3300049588 Ga0501072_0078364 Ga0501072_0078364_430_807 124
167 3300050507 nmdc:mga05p37_1021488_c1 nmdc:mga05p37_1021488_c1_169_549 124
168 3300050511 nmdc:mga08y16_64177_c1 nmdc:mga08y16_64177_c1_3345_3725 124
169 3300050512 nmdc:mga0n895_346471_c1 nmdc:mga0n895_346471_c1_893_1273 124
170 3300050513 nmdc:mga0rr50_34321_c1 nmdc:mga0rr50_34321_c1_1604_1984 124
171 3300053077 Ga0495601_0004765 Ga0495601_0004765_3666_4064 124
172 3300053077 Ga0495601_0066889 Ga0495601_0066889_1002_1388 124
173 3300005335 Ga0070666_10580861 Ga0070666_105808611 125
174 3300006871 Ga0075434_100732208 Ga0075434_1007322082 125
175 3300013306 Ga0163162_10125381 Ga0163162_101253813 125
176 3300025961 Ga0207712_10907567 Ga0207712_109075672 125
177 3300026118 Ga0207675_100258986 Ga0207675_1002589862 125
178 3300044842 Ga0466957_0206958 Ga0466957_0206958_862_1251 125
179 3300044901 Ga0466960_0006931 Ga0466960_0006931_3752_4129 125
180 3300050510 nmdc:mga06r32_498194_c1 nmdc:mga06r32_498194_c1_682_1065 125
181 3300050512 nmdc:mga0n895_657609_c1 nmdc:mga0n895_657609_c1_180_563 125
182 3300050515 nmdc:mga0a205_1389133_c1 nmdc:mga0a205_1389133_c1_119_502 125
183 3300014326 Ga0157380_10485305 Ga0157380_104853053 126
184 3300039437 Ga0436365_1605782 Ga0436365_1605782_35_421 126
185 3300046459 Ga0495629_0682581 Ga0495629_0682581_186_587 126
186 3300005327 Ga0070658_10494699 Ga0070658_104946992 127
187 3300005339 Ga0070660_100007388 Ga0070660_1000073883 127
188 3300005435 Ga0070714_100835275 Ga0070714_1008352751 127
189 3300006914 Ga0075436_100233980 Ga0075436_1002339802 127
190 3300009174 Ga0105241_10328813 Ga0105241_103288132 127
191 3300025909 Ga0207705_10187632 Ga0207705_101876323 127
192 3300025919 Ga0207657_10026415 Ga0207657_100264155 127
193 3300027907 Ga0207428_10377989 Ga0207428_103779892 127
194 3300046683 Ga0495658_0050219 Ga0495658_0050219_686_1069 127
195 3300050515 nmdc:mga0a205_109833_c1 nmdc:mga0a205_109833_c1_291_686 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

26

132

0.91

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

143

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.8569 5 124
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8555 5 125
5d7z-assembly1.cif.gz_A crystal structure of glyoxalase i from zea mays 0.8416 3 127
6bnx-assembly1.cif.gz_A crystal structure of v278e-glyoxalase i mutant from zea mays in space group p6(3) 0.8401 3 127
6bnz-assembly1.cif.gz_A crystal structure of e144q-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 0.8385 3 127
ID Description Score Start End Superfamily
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.867 9 124 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8555 5 125 3.10.180.10
af_C6KSP5_186_307_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8405 9 125 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8352 5 125 3.10.180.10
af_Q948T6_1_150_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8345 3 125 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7W1ARM9-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9682 27 125 GO:0004462
GO:0005737
GO:0019243
AF-A0A538I926-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.96 64 125 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A7W1ARM9-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9495 27 125 GO:0004462
GO:0005737
GO:0019243
AF-A0A7W0X9N2-F1-model_v4 VOC family protein 0.936 4 68 GO:0004462
GO:0046872
AF-A0A7V9VLW1-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9312 62 127 GO:0004462
GO:0005737
GO:0019243

Feature Viewer

pLDDT pTM Quality
86.35 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map