F299817

General Info

Members Datasets Scaffolds Average Seq Length
195 139 390 248

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100000310|Ga0070665_10000031039
Length 269
Sequence MAPSGNVLVCVKRVPDSTEEVVLSEDGLSVDGRRSGFTMSAHEECAVEIAVQTVAATGGEATVLTIGDAEAVEQLRNALAVGCTAATHVVGEPFTFGPSDVAAEIAAVVRDHEAEGRAHELVLLGNDAADSGDFQVGIRLAYELGRPVVNGASTVSVEDGDDGPVVVAVGEGPEGQETYRVPLPAVVTIREGGVEPRYPSVPGRLKAKKVPIEERRPVSEPKGPARVRLVLPPPTPSAVEILGEGPAAAPAVVDLFEKLGVLSPGKAAP

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
89 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
90 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
133 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
137 2643221615 Nocardioides sp. Root224 Isolate Unclassified
138 2643221641 Nocardioides sp. Root122 Isolate Unclassified
139 2643221657 Nocardioides sp. Root1257 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 1.03
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.87
Nodule 0
Rhizoplane 7.69
Rhizosphere 73.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100000310 3300005548 Bacteria 75775
2 Ga0070683_100064357 3300005329 Bacteria 3413
3 Ga0070683_100605197 3300005329 Bacteria 1049
4 Ga0070680_100101798 3300005336 Bacteria 2385
5 Ga0068868_100158085 3300005338 Bacteria 1870
6 Ga0070674_100266060 3300005356 Bacteria 1353
7 Ga0070673_100088670 3300005364 Bacteria 2523
8 Ga0070688_100073620 3300005365 Bacteria 2191
9 Ga0070659_100182774 3300005366 Bacteria 1721
10 Ga0070667_100066701 3300005367 Bacteria 3058
11 Ga0070709_10525867 3300005434 Bacteria 902
12 Ga0070700_100441022 3300005441 Bacteria 988
13 Ga0070678_100207975 3300005456 Bacteria 1619
14 Ga0070681_10255415 3300005458 Bacteria 1665
15 Ga0068867_100161240 3300005459 Bacteria 1768
16 Ga0070679_100088302 3300005530 Bacteria 3088
17 Ga0070684_100149950 3300005535 Bacteria 2112
18 Ga0070684_100854588 3300005535 Bacteria 852
19 Ga0070664_100336444 3300005564 Bacteria 1370
20 Ga0068857_100085672 3300005577 Bacteria 2816
21 Ga0068856_100441507 3300005614 Bacteria 1322
22 Ga0070702_100078894 3300005615 Bacteria 1966
23 Ga0068852_100286634 3300005616 Bacteria 1589
24 Ga0068852_100381709 3300005616 Bacteria 1382
25 Ga0068864_100116768 3300005618 Bacteria 2381
26 Ga0068851_10086795 3300005834 Bacteria 1642
27 Ga0068870_10021565 3300005840 Bacteria 3153
28 Ga0068860_100000253 3300005843 Bacteria 79802
29 Ga0068860_100027862 3300005843 Bacteria 5440
30 Ga0068862_100166874 3300005844 Bacteria 1968
31 Ga0070717_10065805 3300006028 Bacteria 3014
32 Ga0070717_10350765 3300006028 Bacteria 1319
33 Ga0075365_10040604 3300006038 Bacteria 3035
34 Ga0075365_10061951 3300006038 Bacteria 2500
35 Ga0075365_10107641 3300006038 Bacteria 1914
36 Ga0075365_10143015 3300006038 Bacteria 1661
37 Ga0075363_100003605 3300006048 Bacteria 6629
38 Ga0075364_10039103 3300006051 Bacteria 3074
39 Ga0075364_10160518 3300006051 Bacteria 1517
40 Ga0075364_10294163 3300006051 Bacteria 1105
41 Ga0070716_100261709 3300006173 Bacteria 1184
42 Ga0075367_10003430 3300006178 Bacteria 7558
43 Ga0075367_10210587 3300006178 Bacteria 1215
44 Ga0075370_10064844 3300006353 Bacteria 2083
45 Ga0075370_10073103 3300006353 Bacteria 1963
46 Ga0075370_10119189 3300006353 Bacteria 1535
47 Ga0075370_10211272 3300006353 Bacteria 1146
48 Ga0068865_100067579 3300006881 Bacteria 2525
49 Ga0105251_10084857 3300009011 Bacteria 1460
50 Ga0111539_10436488 3300009094 Bacteria 1525
51 Ga0105245_10247679 3300009098 Bacteria 1730
52 Ga0105245_10505453 3300009098 Bacteria 1225
53 Ga0105237_10058517 3300009545 Bacteria 3857
54 Ga0157378_10547050 3300013297 Bacteria 1162
55 Ga0157375_10153796 3300013308 Bacteria 2438
56 Ga0157375_10325797 3300013308 Bacteria 1701
57 Ga0157375_10765422 3300013308 Bacteria 1116
58 Ga0163163_10275465 3300014325 Bacteria 1734
59 Ga0163163_10539410 3300014325 Bacteria 1229
60 Ga0157380_10205712 3300014326 Bacteria 1750
61 Ga0182008_10160894 3300014497 Bacteria 1130
62 Ga0157377_10040811 3300014745 Bacteria 2571
63 Ga0157379_10176436 3300014968 Bacteria 1930
64 Ga0157376_10170240 3300014969 Bacteria 1983
65 Ga0163161_10086357 3300017792 Bacteria 2316
66 Ga0163161_10234662 3300017792 Bacteria 1424
67 Ga0206353_10522875 3300020082 Bacteria 985
68 Ga0206353_10918632 3300020082 Bacteria 3050
69 Ga0213876_10016826 3300021384 Bacteria 3864
70 Ga0207699_10113835 3300025906 Bacteria 1739
71 Ga0207645_10010073 3300025907 Bacteria 6509
72 Ga0207643_10077265 3300025908 Bacteria 1925
73 Ga0207643_10245744 3300025908 Bacteria 1101
74 Ga0207705_10062865 3300025909 Bacteria 2682
75 Ga0207707_10203864 3300025912 Bacteria 1724
76 Ga0207660_10460965 3300025917 Bacteria 1028
77 Ga0207662_10034474 3300025918 Bacteria 2954
78 Ga0207662_10080175 3300025918 Bacteria 1990
79 Ga0207652_10076855 3300025921 Bacteria 2912
80 Ga0207681_10158814 3300025923 Bacteria 1702
81 Ga0207659_10198679 3300025926 Bacteria 1600
82 Ga0207659_10301172 3300025926 Bacteria 1317
83 Ga0207665_10168003 3300025939 Bacteria 1582
84 Ga0207691_10049236 3300025940 Bacteria 3861
85 Ga0207689_10047227 3300025942 Bacteria 3556
86 Ga0207661_10078546 3300025944 Bacteria 2717
87 Ga0207667_10290210 3300025949 Bacteria 1671
88 Ga0207712_10029782 3300025961 Bacteria 3666
89 Ga0207708_10012114 3300026075 Bacteria 6429
90 Ga0207702_10401517 3300026078 Bacteria 1322
91 Ga0207648_10036617 3300026089 Bacteria 4322
92 Ga0207675_100019393 3300026118 Bacteria 6345
93 Ga0207675_100191015 3300026118 Bacteria 1964
94 Ga0207683_10112405 3300026121 Bacteria 2439
95 Ga0209813_10004602 3300027866 Bacteria 3302
96 Ga0268266_10000555 3300028379 Bacteria 52036
97 Ga0268265_10038770 3300028380 Bacteria 3507
98 Ga0268264_10000220 3300028381 Bacteria 111692
99 Ga0316183_1079852 3300030742 Bacteria 929
100 Ga0307408_100102414 3300031548 Bacteria 2184
101 Ga0307413_10341392 3300031824 Bacteria 1152
102 Ga0307410_10084410 3300031852 Bacteria 2239
103 Ga0307406_10040345 3300031901 Bacteria 2902
104 Ga0307407_10026496 3300031903 Bacteria 3071
105 Ga0307407_10199759 3300031903 Bacteria 1339
106 Ga0307407_10249206 3300031903 Bacteria 1216
107 Ga0307407_10623644 3300031903 Bacteria 805
108 Ga0307409_100038172 3300031995 Bacteria 3549
109 Ga0307409_100082294 3300031995 Bacteria 2606
110 Ga0307409_100354754 3300031995 Bacteria 1385
111 Ga0307409_100406933 3300031995 Bacteria 1301
112 Ga0307414_10080179 3300032004 Bacteria 2386
113 Ga0307411_10061282 3300032005 Bacteria 2504
114 Ga0307415_100020854 3300032126 Bacteria 4012
115 Ga0307415_100025952 3300032126 Bacteria 3687
116 Ga0307415_100118083 3300032126 Bacteria 1982
117 Ga0395898_0003634 3300037466 Bacteria 17152
118 Ga0395901_0131879 3300038443 Bacteria 2626
119 Ga0436365_0805513 3300039437 Bacteria 6973
120 Ga0451793_1162060 3300041452 Bacteria 1090
121 Ga0451847_0044375 3300041503 Bacteria 1253
122 Ga0451843_1424890 3300041509 Bacteria 947
123 Ga0466963_0042078 3300044694 Bacteria 2998
124 Ga0466963_0042891 3300044694 Bacteria 2972
125 Ga0466963_0070570 3300044694 Bacteria 2350
126 Ga0466964_0006943 3300044706 Bacteria 4231
127 Ga0466964_0106382 3300044706 Bacteria 1245
128 Ga0466970_0059192 3300044765 Bacteria 2052
129 Ga0466957_0088225 3300044842 Bacteria 1941
130 Ga0466960_0000142 3300044901 Bacteria 24451
131 Ga0466967_0040473 3300045976 Bacteria 4012
132 Ga0466967_0699717 3300045976 Bacteria 1004
133 Ga0495603_0129677 3300046455 Bacteria 1469
134 Ga0496101_0063389 3300048904 Bacteria 2691
135 Ga0496101_0076248 3300048904 Bacteria 2470
136 Ga0496102_0047429 3300048905 Bacteria 3904
137 Ga0496104_0088873 3300048907 Bacteria 2952
138 Ga0496105_0227446 3300048908 Bacteria 1517
139 Ga0496107_0261664 3300048910 Bacteria 1287
140 Ga0496108_0109159 3300048911 Bacteria 2364
141 Ga0496109_0046820 3300048912 Bacteria 3929
142 Ga0496109_0296996 3300048912 Bacteria 1523
143 Ga0496110_0255241 3300048913 Bacteria 1596
144 Ga0496111_0066105 3300048914 Bacteria 2625
145 Ga0496114_0016148 3300048917 Bacteria 6008
146 Ga0496114_0072896 3300048917 Bacteria 2889
147 Ga0496115_0047154 3300048918 Bacteria 3445
148 Ga0501031_0073240 3300049568 Bacteria 2230
149 Ga0501031_0116372 3300049568 Bacteria 1746
150 Ga0501031_0420429 3300049568 Bacteria 864
151 Ga0501036_0044756 3300049572 Bacteria 3750
152 Ga0501037_0451151 3300049573 Bacteria 877
153 Ga0501038_0040226 3300049574 Bacteria 4086
154 Ga0501039_0039076 3300049575 Bacteria 3665
155 Ga0501040_0034583 3300049576 Bacteria 3423
156 Ga0501040_0164432 3300049576 Bacteria 1569
157 Ga0501040_0223695 3300049576 Bacteria 1339
158 Ga0501042_0030399 3300049578 Bacteria 3814
159 Ga0501067_0076174 3300049583 Bacteria 1859
160 Ga0501067_0096249 3300049583 Bacteria 1644
161 Ga0501067_0312744 3300049583 Bacteria 875
162 Ga0501068_0149695 3300049584 Bacteria 1466
163 Ga0501069_0045756 3300049585 Bacteria 2425
164 Ga0501069_0157110 3300049585 Bacteria 1308
165 Ga0501070_0061985 3300049586 Bacteria 3098
166 Ga0501070_0151542 3300049586 Bacteria 1913
167 Ga0501070_0200058 3300049586 Bacteria 1641
168 Ga0501070_0204949 3300049586 Bacteria 1619
169 Ga0501071_0203704 3300049587 Bacteria 1487
170 Ga0501072_0147430 3300049588 Bacteria 1876
171 Ga0501073_0227773 3300049589 Bacteria 1287
172 Ga0501076_0170105 3300049592 Bacteria 1776
173 Ga0501077_0427766 3300049593 Bacteria 847
174 Ga0501079_0345717 3300049741 Bacteria 1165
175 Ga0501080_0218261 3300049742 Bacteria 1746
176 Ga0501081_0264908 3300049743 Bacteria 1256
177 Ga0501045_0314201 3300049824 Bacteria 1166
178 nmdc:mga03n38_4795_c1 3300050490 Bacteria 4528
179 nmdc:mga00v17_200568_c1 3300050491 Bacteria 1290
180 nmdc:mga00v17_57360_c1 3300050491 Bacteria 2382
181 nmdc:mga00v17_79105_c1 3300050491 Bacteria 2050
182 nmdc:mga0yw44_121568_c1 3300050492 Bacteria 1682
183 nmdc:mga0yw44_192469_c1 3300050492 Bacteria 1346
184 nmdc:mga0yw44_67524_c1 3300050492 Bacteria 2210
185 nmdc:mga06z11_13326_c1 3300050494 Bacteria 3607
186 nmdc:mga06z11_219534_c1 3300050494 Bacteria 1110
187 nmdc:mga06z11_27516_c1 3300050494 Bacteria 2718
188 nmdc:mga04h51_13598_c1 3300050495 Bacteria 2307
189 nmdc:mga04h51_3585_c1 3300050495 Bacteria 3784
190 nmdc:mga07m45_82616_c1 3300050496 Bacteria 1835
191 nmdc:mga08y16_181192_c1 3300050511 Bacteria 2187
192 Ga0500593_000051 3300053117 Bacteria 42102
193 2644092187 2643221615 Bacteria 5487866
194 2644229774 2643221641 Bacteria 4490190
195 2644321990 2643221657 Bacteria 5490246
196 Ga0070665_100000310
197 Ga0070683_100064357
198 Ga0070683_100605197
199 Ga0070680_100101798
200 Ga0068868_100158085
201 Ga0070674_100266060
202 Ga0070673_100088670
203 Ga0070688_100073620
204 Ga0070659_100182774
205 Ga0070667_100066701
206 Ga0070709_10525867
207 Ga0070700_100441022
208 Ga0070678_100207975
209 Ga0070681_10255415
210 Ga0068867_100161240
211 Ga0070679_100088302
212 Ga0070684_100149950
213 Ga0070684_100854588
214 Ga0070664_100336444
215 Ga0068857_100085672
216 Ga0068856_100441507
217 Ga0070702_100078894
218 Ga0068852_100286634
219 Ga0068852_100381709
220 Ga0068864_100116768
221 Ga0068851_10086795
222 Ga0068870_10021565
223 Ga0068860_100000253
224 Ga0068860_100027862
225 Ga0068862_100166874
226 Ga0070717_10065805
227 Ga0070717_10350765
228 Ga0075365_10040604
229 Ga0075365_10061951
230 Ga0075365_10107641
231 Ga0075365_10143015
232 Ga0075363_100003605
233 Ga0075364_10039103
234 Ga0075364_10160518
235 Ga0075364_10294163
236 Ga0070716_100261709
237 Ga0075367_10003430
238 Ga0075367_10210587
239 Ga0075370_10064844
240 Ga0075370_10073103
241 Ga0075370_10119189
242 Ga0075370_10211272
243 Ga0068865_100067579
244 Ga0105251_10084857
245 Ga0111539_10436488
246 Ga0105245_10247679
247 Ga0105245_10505453
248 Ga0105237_10058517
249 Ga0157378_10547050
250 Ga0157375_10153796
251 Ga0157375_10325797
252 Ga0157375_10765422
253 Ga0163163_10275465
254 Ga0163163_10539410
255 Ga0157380_10205712
256 Ga0182008_10160894
257 Ga0157377_10040811
258 Ga0157379_10176436
259 Ga0157376_10170240
260 Ga0163161_10086357
261 Ga0163161_10234662
262 Ga0206353_10522875
263 Ga0206353_10918632
264 Ga0213876_10016826
265 Ga0207699_10113835
266 Ga0207645_10010073
267 Ga0207643_10077265
268 Ga0207643_10245744
269 Ga0207705_10062865
270 Ga0207707_10203864
271 Ga0207660_10460965
272 Ga0207662_10034474
273 Ga0207662_10080175
274 Ga0207652_10076855
275 Ga0207681_10158814
276 Ga0207659_10198679
277 Ga0207659_10301172
278 Ga0207665_10168003
279 Ga0207691_10049236
280 Ga0207689_10047227
281 Ga0207661_10078546
282 Ga0207667_10290210
283 Ga0207712_10029782
284 Ga0207708_10012114
285 Ga0207702_10401517
286 Ga0207648_10036617
287 Ga0207675_100019393
288 Ga0207675_100191015
289 Ga0207683_10112405
290 Ga0209813_10004602
291 Ga0268266_10000555
292 Ga0268265_10038770
293 Ga0268264_10000220
294 Ga0316183_1079852
295 Ga0307408_100102414
296 Ga0307413_10341392
297 Ga0307410_10084410
298 Ga0307406_10040345
299 Ga0307407_10026496
300 Ga0307407_10199759
301 Ga0307407_10249206
302 Ga0307407_10623644
303 Ga0307409_100038172
304 Ga0307409_100082294
305 Ga0307409_100354754
306 Ga0307409_100406933
307 Ga0307414_10080179
308 Ga0307411_10061282
309 Ga0307415_100020854
310 Ga0307415_100025952
311 Ga0307415_100118083
312 Ga0395898_0003634
313 Ga0395901_0131879
314 Ga0436365_0805513
315 Ga0451793_1162060
316 Ga0451847_0044375
317 Ga0451843_1424890
318 Ga0466963_0042078
319 Ga0466963_0042891
320 Ga0466963_0070570
321 Ga0466964_0006943
322 Ga0466964_0106382
323 Ga0466970_0059192
324 Ga0466957_0088225
325 Ga0466960_0000142
326 Ga0466967_0040473
327 Ga0466967_0699717
328 Ga0495603_0129677
329 Ga0496101_0063389
330 Ga0496101_0076248
331 Ga0496102_0047429
332 Ga0496104_0088873
333 Ga0496105_0227446
334 Ga0496107_0261664
335 Ga0496108_0109159
336 Ga0496109_0046820
337 Ga0496109_0296996
338 Ga0496110_0255241
339 Ga0496111_0066105
340 Ga0496114_0016148
341 Ga0496114_0072896
342 Ga0496115_0047154
343 Ga0501031_0073240
344 Ga0501031_0116372
345 Ga0501031_0420429
346 Ga0501036_0044756
347 Ga0501037_0451151
348 Ga0501038_0040226
349 Ga0501039_0039076
350 Ga0501040_0034583
351 Ga0501040_0164432
352 Ga0501040_0223695
353 Ga0501042_0030399
354 Ga0501067_0076174
355 Ga0501067_0096249
356 Ga0501067_0312744
357 Ga0501068_0149695
358 Ga0501069_0045756
359 Ga0501069_0157110
360 Ga0501070_0061985
361 Ga0501070_0151542
362 Ga0501070_0200058
363 Ga0501070_0204949
364 Ga0501071_0203704
365 Ga0501072_0147430
366 Ga0501073_0227773
367 Ga0501076_0170105
368 Ga0501077_0427766
369 Ga0501079_0345717
370 Ga0501080_0218261
371 Ga0501081_0264908
372 Ga0501045_0314201
373 nmdc:mga03n38_4795_c1
374 nmdc:mga00v17_200568_c1
375 nmdc:mga00v17_57360_c1
376 nmdc:mga00v17_79105_c1
377 nmdc:mga0yw44_121568_c1
378 nmdc:mga0yw44_192469_c1
379 nmdc:mga0yw44_67524_c1
380 nmdc:mga06z11_13326_c1
381 nmdc:mga06z11_219534_c1
382 nmdc:mga06z11_27516_c1
383 nmdc:mga04h51_13598_c1
384 nmdc:mga04h51_3585_c1
385 nmdc:mga07m45_82616_c1
386 nmdc:mga08y16_181192_c1
387 Ga0500593_000051
388 2644092187
389 2644229774
390 2644321990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

28

219

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.8586 3 214
4cj1-assembly1.cif.gz_B crystal structure of celd in complex with affitin h3 0.8549 149 179
3k5n-assembly1.cif.gz_B crystal structure of e.coli pol ii-abasic dna binary complex 0.8312 149 177
1o95-assembly1.cif.gz_C ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.8285 3 213
1o95-assembly1.cif.gz_E ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.8213 3 213
ID Description Score Start End Superfamily
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8586 3 214 3.40.50.620
4cj1B00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8549 149 179 2.40.50.40
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8274 3 213 3.40.50.620
af_Q4DG52_12_193_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8116 4 217 3.40.50.620
4l2iA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7958 2 216 3.40.50.620
ID Description Score Start End GO Terms
AF-Q9HLL6-F1-model_v4 FIXA (Related to carnitine metabolism) related protein 0.9094 1 213 GO:0009055
AF-A0A7X7KVP3-F1-model_v4 Electron transfer flavoprotein subunit alpha 0.9077 2 213 GO:0009055
GO:0033539
GO:0050660
AF-A0A1F9YLD6-F1-model_v4 deleted 0.9055 1 213
AF-A0A7X9EVH0-F1-model_v4 Electron transfer flavoprotein small subunit 0.9052 1 210 GO:0009055
AF-A0A7Y4U1X1-F1-model_v4 Electron transfer flavoprotein alpha/ beta subunit 0.9043 3 213 GO:0009055
GO:0033539
GO:0050660

Map