F299714

General Info

Members Datasets Scaffolds Average Seq Length
195 160 390 209

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10015000|Ga0070709_100150002
Length 244
Sequence VTGRARCSGRRWSPARCTRWISGRAAGSMVAGVTDSPLTWSLVIPVKVLARAKSRLTGLAGPARSALALAMAADTVSAALACPAAGAVVVVTDDGEAAGVLGGLHAVIVPDEPAAGLNPALAHGAAVAAARWPAWGVAALAADLPALRPDELDRGLRAAGQWPEAFVADAAGTGTTLYAARLPAAFRPRFGAGSAGRYRRGGAVEVMLADVPSLRSDVDTPDDLRQAASLGLGPRTAVLAAQLA

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
25 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
31 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
32 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
49 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
50 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
51 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
52 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
53 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
54 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
55 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
56 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
57 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
58 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
59 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
67 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
93 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
94 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
95 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
98 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
101 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
102 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
103 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
106 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
128 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
129 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
130 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
131 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
132 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
135 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
136 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
137 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
139 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
140 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
141 2643221647 Streptomyces sp. Root369 Isolate Unclassified
142 2643221714 Streptomyces sp. Root264 Isolate Unclassified
143 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
144 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
145 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
146 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
147 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
148 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
149 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
150 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
151 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
152 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
153 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
154 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
155 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
156 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
157 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
158 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
159 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
160 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.21
Metatranscriptomes 0.51
Isolates 11.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.18
Nodule 1.03
Rhizoplane 3.08
Rhizosphere 77.44
Stem 0
Stem Tuber 0
Unclassified 1.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10015000 3300005434 Bacteria 4398
2 JGI24739J22299_10033618 3300001989 Bacteria 1753
3 JGI24737J22298_10003653 3300001990 Bacteria 5419
4 JGI24737J22298_10018669 3300001990 Bacteria 2224
5 JGI24738J21930_10023743 3300002075 Bacteria 1262
6 Ga0070683_100160189 3300005329 Bacteria 2135
7 Ga0070714_100114123 3300005435 Bacteria 2396
8 Ga0070713_100703550 3300005436 Unclassified 965
9 Ga0070710_10161103 3300005437 Bacteria 1391
10 Ga0070708_100034015 3300005445 Bacteria 4431
11 Ga0070706_100019077 3300005467 Bacteria 6327
12 Ga0070707_100098599 3300005468 Bacteria 2830
13 Ga0070698_100020925 3300005471 Bacteria 6854
14 Ga0070699_100003269 3300005518 Bacteria 14342
15 Ga0070699_100421610 3300005518 Bacteria 1208
16 Ga0070679_100142971 3300005530 Bacteria 2371
17 Ga0070684_100139553 3300005535 Bacteria 2191
18 Ga0068853_100020110 3300005539 Bacteria 5550
19 Ga0070665_100554801 3300005548 Bacteria 1161
20 Ga0068856_100210237 3300005614 Bacteria 1961
21 Ga0070717_10120884 3300006028 Bacteria 2244
22 Ga0070717_10500588 3300006028 Bacteria 1098
23 Ga0070717_10603708 3300006028 Bacteria 995
24 Ga0075363_100168934 3300006048 Bacteria 1241
25 Ga0070715_10000418 3300006163 Bacteria 10839
26 Ga0070716_100101273 3300006173 Bacteria 1766
27 Ga0075370_10052816 3300006353 Bacteria 2307
28 Ga0105251_10009941 3300009011 Bacteria 5568
29 Ga0105250_10048489 3300009092 Bacteria 1704
30 Ga0105243_10034972 3300009148 Bacteria 3894
31 Ga0105246_10072736 3300011119 Bacteria 2424
32 Ga0157369_10379906 3300013105 Bacteria 1466
33 Ga0182008_10000253 3300014497 Bacteria 41589
34 Ga0182007_10000295 3300015262 Bacteria 32455
35 Ga0182005_1079430 3300015265 Bacteria 905
36 Ga0207713_1025560 3300025735 Bacteria 2723
37 Ga0207692_10018644 3300025898 Bacteria 3119
38 Ga0207647_10061375 3300025904 Bacteria 2295
39 Ga0207699_10008101 3300025906 Bacteria 5169
40 Ga0207684_10448357 3300025910 Bacteria 1108
41 Ga0207693_10018572 3300025915 Bacteria 5536
42 Ga0207652_10251563 3300025921 Bacteria 1594
43 Ga0207646_10013627 3300025922 Bacteria 7765
44 Ga0207646_10156660 3300025922 Bacteria 2054
45 Ga0207646_10192572 3300025922 Bacteria 1842
46 Ga0207700_10111313 3300025928 Bacteria 2203
47 Ga0207664_10005209 3300025929 Bacteria 8864
48 Ga0207664_10616323 3300025929 Bacteria 975
49 Ga0207709_10031053 3300025935 Bacteria 3115
50 Ga0207665_10001278 3300025939 Bacteria 16983
51 Ga0207661_10098859 3300025944 Bacteria 2446
52 Ga0207639_10101179 3300026041 Bacteria 2330
53 Ga0207702_10066818 3300026078 Bacteria 3083
54 Ga0268266_10528145 3300028379 Bacteria 1129
55 Ga0307517_10000616 3300028786 Bacteria 60799
56 Ga0307515_10122690 3300028794 Bacteria 2928
57 Ga0307511_10117365 3300030521 Bacteria 1663
58 Ga0307512_10005071 3300030522 Bacteria 13997
59 Ga0307512_10013183 3300030522 Bacteria 7762
60 Ga0307513_10037446 3300031456 Bacteria 5399
61 Ga0307509_10077065 3300031507 Bacteria 3457
62 Ga0307509_10311245 3300031507 Bacteria 1317
63 Ga0307508_10034575 3300031616 Bacteria 4556
64 Ga0307508_10038847 3300031616 Bacteria 4276
65 Ga0307514_10056339 3300031649 Bacteria 3017
66 Ga0307514_10211567 3300031649 Bacteria 1203
67 Ga0373950_0005134 3300034818 Bacteria 1945
68 Ga0373926_0000224 3300035083 Bacteria 13414
69 Ga0373946_0115987 3300035171 Unclassified 1217
70 Ga0373935_0000114 3300035692 Bacteria 36901
71 Ga0373947_0000008 3300035725 Bacteria 182094
72 Ga0372808_000190 3300036459 Bacteria 3795
73 Ga0395900_0241849 3300037418 Bacteria 1810
74 Ga0395900_0716970 3300037418 Bacteria 933
75 Ga0395898_0020289 3300037466 Bacteria 6750
76 Ga0436364_1387664 3300037853 Bacteria 4015
77 Ga0395901_0154398 3300038443 Bacteria 2411
78 Ga0395901_1096501 3300038443 Bacteria 767
79 Ga0436360_1247553 3300039438 Bacteria 951
80 Ga0439449_0002001 3300042007 Bacteria 8009
81 Ga0466969_0073216 3300044656 Bacteria 1644
82 Ga0466972_0003355 3300044658 Bacteria 7935
83 Ga0466972_0036737 3300044658 Bacteria 2395
84 Ga0466965_0001883 3300044683 Bacteria 8736
85 Ga0466966_0016433 3300044684 Bacteria 4889
86 Ga0466961_0001921 3300044693 Bacteria 12946
87 Ga0466961_0039265 3300044693 Bacteria 3035
88 Ga0466961_0425871 3300044693 Bacteria 804
89 Ga0466963_0013698 3300044694 Bacteria 4986
90 Ga0466963_0029420 3300044694 Bacteria 3536
91 Ga0466964_0004007 3300044706 Bacteria 5411
92 Ga0466971_0001654 3300044719 Bacteria 9424
93 Ga0466968_0161033 3300044735 Bacteria 1036
94 Ga0466970_0001377 3300044765 Bacteria 11706
95 Ga0466970_0026106 3300044765 Bacteria 3062
96 Ga0466957_0001080 3300044842 Bacteria 14067
97 Ga0466960_0009558 3300044901 Bacteria 4001
98 Ga0466959_0016727 3300045049 Bacteria 5365
99 Ga0466958_0000185 3300045836 Bacteria 22546
100 Ga0466967_0036919 3300045976 Bacteria 4176
101 Ga0466967_0733463 3300045976 Bacteria 979
102 Ga0466967_1005759 3300045976 Bacteria 830
103 Ga0495638_0158390 3300046460 Bacteria 1308
104 Ga0495580_0062024 3300046472 Bacteria 2624
105 Ga0495662_0079875 3300046476 Bacteria 1590
106 Ga0495628_0196939 3300046516 Bacteria 1519
107 Ga0495643_0001559 3300046522 Bacteria 20433
108 Ga0495666_0074406 3300046526 Bacteria 1611
109 Ga0495667_0215369 3300046559 Bacteria 1227
110 Ga0495625_0080530 3300046660 Bacteria 2268
111 Ga0495625_0230611 3300046660 Bacteria 1209
112 Ga0495635_0095456 3300046663 Bacteria 2033
113 Ga0495635_0216737 3300046663 Bacteria 1295
114 Ga0495635_0247263 3300046663 Bacteria 1203
115 Ga0495657_0025348 3300046675 Bacteria 4212
116 Ga0495657_0159939 3300046675 Bacteria 1394
117 Ga0495646_0097618 3300046680 Bacteria 1688
118 Ga0495613_0034065 3300046689 Bacteria 3782
119 Ga0495613_0168546 3300046689 Bacteria 1555
120 Ga0495613_0442470 3300046689 Bacteria 881
121 Ga0495624_0402759 3300046690 Bacteria 821
122 Ga0495600_0241819 3300046809 Bacteria 1150
123 Ga0495660_0044817 3300046810 Bacteria 2431
124 Ga0495636_0075324 3300047318 Bacteria 1446
125 Ga0495676_0278332 3300047321 Bacteria 1133
126 Ga0495680_0014107 3300047322 Bacteria 6940
127 Ga0495687_010312 3300047443 Bacteria 5131
128 Ga0495685_000247 3300047447 Bacteria 18692
129 Ga0495685_011619 3300047447 Bacteria 2975
130 Ga0495681_0000245 3300047470 Bacteria 45204
131 Ga0495686_0129211 3300047472 Bacteria 1499
132 Ga0495593_0199553 3300047673 Bacteria 1005
133 Ga0495626_0094163 3300048091 Bacteria 1314
134 Ga0496104_0030977 3300048907 Bacteria 4972
135 Ga0496105_0026374 3300048908 Bacteria 4739
136 Ga0496106_0157429 3300048909 Bacteria 1795
137 Ga0496109_0014470 3300048912 Bacteria 6863
138 Ga0496112_0017769 3300048915 Bacteria 6693
139 Ga0496113_0048966 3300048916 Bacteria 3146
140 Ga0501032_0353552 3300049569 Bacteria 946
141 Ga0501034_0077284 3300049571 Bacteria 3334
142 Ga0501034_0948336 3300049571 Bacteria 746
143 Ga0501036_0028538 3300049572 Bacteria 4715
144 Ga0501037_0226324 3300049573 Bacteria 1314
145 Ga0501038_0001438 3300049574 Bacteria 21853
146 Ga0501039_0076458 3300049575 Bacteria 2603
147 Ga0501046_0171959 3300049580 Bacteria 1625
148 Ga0501047_0054668 3300049581 Bacteria 3862
149 Ga0501047_0078693 3300049581 Bacteria 3170
150 Ga0501047_0116836 3300049581 Bacteria 2549
151 Ga0501047_0249294 3300049581 Bacteria 1624
152 Ga0501048_0095913 3300049582 Bacteria 2092
153 Ga0501080_0032888 3300049742 Bacteria 4839
154 Ga0501035_0413281 3300049822 Bacteria 1121
155 Ga0501044_0004269 3300049823 Bacteria 16039
156 Ga0501044_0108656 3300049823 Bacteria 2783
157 Ga0501044_0186838 3300049823 Bacteria 2036
158 nmdc:mga07m45_158385_c1 3300050496 Bacteria 1314
159 Ga0495601_0251316 3300053077 Bacteria 1154
160 Ga0495655_0002515 3300053083 Bacteria 2921
161 Ga0500578_0026331 3300053086 Bacteria 3731
162 Ga0500560_052704 3300053107 Bacteria 1309
163 Ga0500658_0001595 3300053134 Bacteria 9060
164 Ga0500573_0018017 3300053140 Bacteria 4024
165 Ga0500600_0004486 3300053149 Bacteria 8205
166 Ga0500600_0090142 3300053149 Bacteria 1639
167 Ga0500616_0019358 3300053153 Bacteria 3838
168 Ga0500633_0000206 3300053160 Bacteria 8321
169 Ga0500634_0024115 3300053161 Bacteria 3309
170 Ga0500656_000060 3300053732 Bacteria 6255
171 Ga0500587_001861 3300053739 Bacteria 3006
172 Ga0466962_0000188 3300061719 Bacteria 25723
173 Ga0466962_0045474 3300061719 Bacteria 2098
174 2585307686 2582581313 Bacteria 10042643
175 2616699960 2616644814 Bacteria 11555299
176 2644269531 2643221647 Bacteria 10741251
177 2644629789 2643221714 Bacteria 9015452
178 2808913827 2808606375 Bacteria 9466072
179 2812478569 2811994917 Bacteria 7761064
180 2862284398 2862281513 Bacteria 9621493
181 2862294728 2862290372 Bacteria 7471434
182 2862385164 2862382967 Bacteria 10317375
183 2862515657 2862507626 Bacteria 9425308
184 2863408831 2863404153 Bacteria 9672205
185 2946077926 2946072368 Bacteria 8999607
186 2947226739 2947224130 Bacteria 9938529
187 2954383805 2954380949 Bacteria 10050426
188 2954694603 2954691527 Bacteria 10720516
189 2954709807 2954701450 Bacteria 10834262
190 2990061116 2990059506 Bacteria 9321252
191 3006494731 3006493962 Bacteria 8825450
192 8008562998 8008558824 Bacteria 10610750
193 8023624796 8023623736 Bacteria 8593882
194 8053946711 8053945823 Bacteria 8962862
195 8056831519 8056829672 Bacteria 9045328
196 Ga0070709_10015000
197 JGI24739J22299_10033618
198 JGI24737J22298_10003653
199 JGI24737J22298_10018669
200 JGI24738J21930_10023743
201 Ga0070683_100160189
202 Ga0070714_100114123
203 Ga0070713_100703550
204 Ga0070710_10161103
205 Ga0070708_100034015
206 Ga0070706_100019077
207 Ga0070707_100098599
208 Ga0070698_100020925
209 Ga0070699_100003269
210 Ga0070699_100421610
211 Ga0070679_100142971
212 Ga0070684_100139553
213 Ga0068853_100020110
214 Ga0070665_100554801
215 Ga0068856_100210237
216 Ga0070717_10120884
217 Ga0070717_10500588
218 Ga0070717_10603708
219 Ga0075363_100168934
220 Ga0070715_10000418
221 Ga0070716_100101273
222 Ga0075370_10052816
223 Ga0105251_10009941
224 Ga0105250_10048489
225 Ga0105243_10034972
226 Ga0105246_10072736
227 Ga0157369_10379906
228 Ga0182008_10000253
229 Ga0182007_10000295
230 Ga0182005_1079430
231 Ga0207713_1025560
232 Ga0207692_10018644
233 Ga0207647_10061375
234 Ga0207699_10008101
235 Ga0207684_10448357
236 Ga0207693_10018572
237 Ga0207652_10251563
238 Ga0207646_10013627
239 Ga0207646_10156660
240 Ga0207646_10192572
241 Ga0207700_10111313
242 Ga0207664_10005209
243 Ga0207664_10616323
244 Ga0207709_10031053
245 Ga0207665_10001278
246 Ga0207661_10098859
247 Ga0207639_10101179
248 Ga0207702_10066818
249 Ga0268266_10528145
250 Ga0307517_10000616
251 Ga0307515_10122690
252 Ga0307511_10117365
253 Ga0307512_10005071
254 Ga0307512_10013183
255 Ga0307513_10037446
256 Ga0307509_10077065
257 Ga0307509_10311245
258 Ga0307508_10034575
259 Ga0307508_10038847
260 Ga0307514_10056339
261 Ga0307514_10211567
262 Ga0373950_0005134
263 Ga0373926_0000224
264 Ga0373946_0115987
265 Ga0373935_0000114
266 Ga0373947_0000008
267 Ga0372808_000190
268 Ga0395900_0241849
269 Ga0395900_0716970
270 Ga0395898_0020289
271 Ga0436364_1387664
272 Ga0395901_0154398
273 Ga0395901_1096501
274 Ga0436360_1247553
275 Ga0439449_0002001
276 Ga0466969_0073216
277 Ga0466972_0003355
278 Ga0466972_0036737
279 Ga0466965_0001883
280 Ga0466966_0016433
281 Ga0466961_0001921
282 Ga0466961_0039265
283 Ga0466961_0425871
284 Ga0466963_0013698
285 Ga0466963_0029420
286 Ga0466964_0004007
287 Ga0466971_0001654
288 Ga0466968_0161033
289 Ga0466970_0001377
290 Ga0466970_0026106
291 Ga0466957_0001080
292 Ga0466960_0009558
293 Ga0466959_0016727
294 Ga0466958_0000185
295 Ga0466967_0036919
296 Ga0466967_0733463
297 Ga0466967_1005759
298 Ga0495638_0158390
299 Ga0495580_0062024
300 Ga0495662_0079875
301 Ga0495628_0196939
302 Ga0495643_0001559
303 Ga0495666_0074406
304 Ga0495667_0215369
305 Ga0495625_0080530
306 Ga0495625_0230611
307 Ga0495635_0095456
308 Ga0495635_0216737
309 Ga0495635_0247263
310 Ga0495657_0025348
311 Ga0495657_0159939
312 Ga0495646_0097618
313 Ga0495613_0034065
314 Ga0495613_0168546
315 Ga0495613_0442470
316 Ga0495624_0402759
317 Ga0495600_0241819
318 Ga0495660_0044817
319 Ga0495636_0075324
320 Ga0495676_0278332
321 Ga0495680_0014107
322 Ga0495687_010312
323 Ga0495685_000247
324 Ga0495685_011619
325 Ga0495681_0000245
326 Ga0495686_0129211
327 Ga0495593_0199553
328 Ga0495626_0094163
329 Ga0496104_0030977
330 Ga0496105_0026374
331 Ga0496106_0157429
332 Ga0496109_0014470
333 Ga0496112_0017769
334 Ga0496113_0048966
335 Ga0501032_0353552
336 Ga0501034_0077284
337 Ga0501034_0948336
338 Ga0501036_0028538
339 Ga0501037_0226324
340 Ga0501038_0001438
341 Ga0501039_0076458
342 Ga0501046_0171959
343 Ga0501047_0054668
344 Ga0501047_0078693
345 Ga0501047_0116836
346 Ga0501047_0249294
347 Ga0501048_0095913
348 Ga0501080_0032888
349 Ga0501035_0413281
350 Ga0501044_0004269
351 Ga0501044_0108656
352 Ga0501044_0186838
353 nmdc:mga07m45_158385_c1
354 Ga0495601_0251316
355 Ga0495655_0002515
356 Ga0500578_0026331
357 Ga0500560_052704
358 Ga0500658_0001595
359 Ga0500573_0018017
360 Ga0500600_0004486
361 Ga0500600_0090142
362 Ga0500616_0019358
363 Ga0500633_0000206
364 Ga0500634_0024115
365 Ga0500656_000060
366 Ga0500587_001861
367 Ga0466962_0000188
368 Ga0466962_0045474
369 2585307686
370 2616699960
371 2644269531
372 2644629789
373 2808913827
374 2812478569
375 2862284398
376 2862294728
377 2862385164
378 2862515657
379 2863408831
380 2946077926
381 2947226739
382 2954383805
383 2954694603
384 2954709807
385 2990061116
386 3006494731
387 8008562998
388 8023624796
389 8053946711
390 8056831519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01983

CofC

Guanylyl transferase CofC like

40

236

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bwg-assembly1.cif.gz_A crystal structure of native rv2983 from mycobacterium tuberculosis 0.922 3 203
6bwg-assembly2.cif.gz_B crystal structure of native rv2983 from mycobacterium tuberculosis 0.9154 1 205
6bwg-assembly2.cif.gz_B crystal structure of native rv2983 from mycobacterium tuberculosis 0.9069 1 205
6bwh-assembly3.cif.gz_C crystal structure of mycoibacterium tuberculosis rv2983 in complex with pep 0.9001 1 205
6bwg-assembly1.cif.gz_A crystal structure of native rv2983 from mycobacterium tuberculosis 0.9001 3 203
ID Description Score Start End Superfamily
af_P9WP83_9_180_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9106 3 172 3.90.550.10
af_P9WP83_9_180_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8956 3 172 3.90.550.10
af_P40456_945_1105_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8734 52 74 3.40.50.1010
af_Q7KUW4_251_394_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.869 52 74 3.40.50.1010
af_O53443_2_147_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8059 52 77 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A7K2WUJ2-F1-model_v4 2-phospho-L-lactate guanylyltransferase 1.002 107 205 GO:0005525
GO:0043814
AF-A0A7K2XEG0-F1-model_v4 2-phospho-L-lactate guanylyltransferase 1 113 202 GO:0005525
GO:0043814
AF-K4R1K2-F1-model_v4 Phosphoenolpyruvate guanylyltransferase (PEP guanylyltransferase) (EC 2.7.7.105) 0.9992 1 212 GO:0005525
GO:0043814
GO:0052645
AF-A0A6I5CGY4-F1-model_v4 2-phospho-L-lactate guanylyltransferase 0.9987 104 201 GO:0005525
GO:0043814
AF-A0A7U9KSK3-F1-model_v4 Phosphoenolpyruvate guanylyltransferase (PEP guanylyltransferase) (EC 2.7.7.105) 0.9984 1 202 GO:0005525
GO:0043814
GO:0052645

Map