F299516

General Info

Members Datasets Scaffolds Average Seq Length
195 140 390 110

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10252738|rootH1_102527382
Length 122
Sequence MRAAAPTPDAHHAVSPLEIFLTILGMGAVTLLCRAFFLIPEKELPMPNWLREGLRYAPIAALTAVVAPEIVMTQGHLIQTWRDARIFGAVAGLAFFTWKKDLFGTIVCGTGVMLALRFGLGW

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
38 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
85 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
86 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
87 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
88 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
89 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
90 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
91 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
92 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
93 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
103 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
104 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
112 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
138 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.26
Nodule 0
Rhizoplane 1.03
Rhizosphere 87.69
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10252738 3300003323 Unclassified 1482
2 JGI26128J50194_1000048 3300003347 Bacteria 4101
3 Ga0055540_1016395 3300003792 Bacteria 2110
4 Ga0055531_10000570 3300003794 Bacteria 32274
5 Ga0070670_101239510 3300005331 Bacteria 682
6 Ga0070680_100176537 3300005336 Bacteria 1798
7 Ga0070660_100121502 3300005339 Bacteria 2084
8 Ga0070669_100487727 3300005353 Bacteria 1021
9 Ga0070669_100984673 3300005353 Bacteria 723
10 Ga0070675_101088281 3300005354 Bacteria 735
11 Ga0070671_101438113 3300005355 Bacteria 609
12 Ga0070673_100382056 3300005364 Bacteria 1256
13 Ga0070659_101560927 3300005366 Bacteria 589
14 Ga0070667_100657080 3300005367 Bacteria 968
15 Ga0070714_100157428 3300005435 Bacteria 2052
16 Ga0070678_100077267 3300005456 Bacteria 2511
17 Ga0070681_11444021 3300005458 Bacteria 612
18 Ga0070679_100003559 3300005530 Bacteria 14276
19 Ga0068855_100079539 3300005563 Bacteria 3802
20 Ga0068855_100313736 3300005563 Bacteria 1734
21 Ga0068855_100884119 3300005563 Bacteria 945
22 Ga0068856_100418432 3300005614 Bacteria 1360
23 Ga0068856_101672067 3300005614 Bacteria 649
24 Ga0068852_100528352 3300005616 Bacteria 1178
25 Ga0068852_101635094 3300005616 Bacteria 667
26 Ga0068861_102114447 3300005719 Bacteria 563
27 Ga0075365_10002081 3300006038 Bacteria 9559
28 Ga0075368_10251246 3300006042 Unclassified 756
29 Ga0075363_100959322 3300006048 Bacteria 525
30 Ga0075362_10117831 3300006177 Bacteria 1255
31 Ga0075362_10611829 3300006177 Bacteria 564
32 Ga0097621_102322430 3300006237 Bacteria 513
33 Ga0075370_10112639 3300006353 Bacteria 1581
34 Ga0105240_10166637 3300009093 Bacteria 2613
35 Ga0105241_10971626 3300009174 Bacteria 793
36 Ga0105238_10110914 3300009551 Bacteria 2724
37 Ga0105249_11104754 3300009553 Bacteria 863
38 Ga0105239_10170808 3300010375 Bacteria 2431
39 Ga0157378_10261038 3300013297 Bacteria 1662
40 Ga0163162_12938444 3300013306 Bacteria 548
41 Ga0157380_10178469 3300014326 Bacteria 1864
42 Ga0157376_10000348 3300014969 Bacteria 30874
43 Ga0157376_10523646 3300014969 Bacteria 1169
44 Ga0209758_1092891 3300025297 Bacteria 878
45 Ga0209051_1000055 3300025303 Bacteria 277194
46 Ga0209257_1000101 3300025304 Bacteria 251553
47 Ga0207705_10072707 3300025909 Bacteria 2495
48 Ga0207705_10711512 3300025909 Unclassified 781
49 Ga0207705_11090800 3300025909 Unclassified 615
50 Ga0207707_11142129 3300025912 Bacteria 633
51 Ga0207695_10795478 3300025913 Bacteria 826
52 Ga0207660_10097094 3300025917 Bacteria 2195
53 Ga0207652_10238059 3300025921 Bacteria 1641
54 Ga0207694_11268042 3300025924 Bacteria 623
55 Ga0207650_10462726 3300025925 Bacteria 1057
56 Ga0207659_10153548 3300025926 Bacteria 1800
57 Ga0207659_10309173 3300025926 Bacteria 1301
58 Ga0207664_10590086 3300025929 Bacteria 998
59 Ga0207644_10749801 3300025931 Bacteria 816
60 Ga0207689_10190721 3300025942 Bacteria 1691
61 Ga0207667_10161164 3300025949 Bacteria 2307
62 Ga0207667_10674635 3300025949 Bacteria 1037
63 Ga0207658_11137336 3300025986 Bacteria 713
64 Ga0207677_10005065 3300026023 Bacteria 7120
65 Ga0207702_10663427 3300026078 Bacteria 1026
66 Ga0207648_10473212 3300026089 Bacteria 1143
67 Ga0207675_101529778 3300026118 Bacteria 688
68 Ga0207683_10074380 3300026121 Bacteria 3006
69 Ga0209981_1035120 3300027378 Bacteria 742
70 Ga0209996_1000590 3300027395 Bacteria 4379
71 Ga0209995_1001999 3300027471 Bacteria 3197
72 Ga0209968_1000319 3300027526 Bacteria 8038
73 Ga0209999_1019679 3300027543 Bacteria 1238
74 Ga0209966_1000117 3300027695 Bacteria 35145
75 Ga0209974_10076080 3300027876 Bacteria 1150
76 Ga0307515_10042130 3300028794 Bacteria 7153
77 Ga0265331_10266874 3300031250 Bacteria 767
78 Ga0307408_100176421 3300031548 Bacteria 1710
79 Ga0307408_100354408 3300031548 Bacteria 1246
80 Ga0307408_100556344 3300031548 Bacteria 1013
81 Ga0265314_10018936 3300031711 Bacteria 5343
82 Ga0265342_10055225 3300031712 Bacteria 2358
83 Ga0307405_11681650 3300031731 Bacteria 562
84 Ga0307410_10712125 3300031852 Bacteria 847
85 Ga0307406_11651492 3300031901 Bacteria 567
86 Ga0307412_10257192 3300031911 Bacteria 1359
87 Ga0307412_11027497 3300031911 Bacteria 730
88 Ga0307412_12002731 3300031911 Unclassified 536
89 Ga0307409_100240994 3300031995 Bacteria 1646
90 Ga0307409_101379403 3300031995 Bacteria 731
91 Ga0307416_100118110 3300032002 Bacteria 2356
92 Ga0307416_100264620 3300032002 Bacteria 1683
93 Ga0307416_100293830 3300032002 Bacteria 1610
94 Ga0307416_100457352 3300032002 Bacteria 1331
95 Ga0307414_10339743 3300032004 Bacteria 1285
96 Ga0307411_10242581 3300032005 Bacteria 1412
97 Ga0307415_100712396 3300032126 Bacteria 907
98 Ga0395899_0010332 3300037312 Bacteria 7156
99 Ga0395899_0085207 3300037312 Bacteria 2296
100 Ga0395899_0632552 3300037312 Bacteria 678
101 Ga0395900_0040063 3300037418 Bacteria 4828
102 Ga0395900_0141598 3300037418 Unclassified 2462
103 Ga0395900_0352277 3300037418 Bacteria 1445
104 Ga0395900_1317693 3300037418 Bacteria 636
105 Ga0395898_0012139 3300037466 Bacteria 8915
106 Ga0395898_0044153 3300037466 Bacteria 4390
107 Ga0395898_0064104 3300037466 Bacteria 3565
108 Ga0395898_0278529 3300037466 Bacteria 1595
109 Ga0395905_0012984 3300037471 Bacteria 8004
110 Ga0395905_0055246 3300037471 Bacteria 3716
111 Ga0395905_0087244 3300037471 Bacteria 2925
112 Ga0395905_0160385 3300037471 Bacteria 2114
113 Ga0395905_0289957 3300037471 Bacteria 1523
114 Ga0395905_0480626 3300037471 Bacteria 1142
115 Ga0395905_0504171 3300037471 Bacteria 1110
116 Ga0395905_0914194 3300037471 Bacteria 780
117 Ga0395905_1659828 3300037471 Unclassified 544
118 Ga0395901_0048741 3300038443 Bacteria 4399
119 Ga0395901_0057646 3300038443 Bacteria 4040
120 Ga0395901_0101246 3300038443 Bacteria 3023
121 Ga0395901_0149656 3300038443 Bacteria 2453
122 Ga0395901_0158033 3300038443 Bacteria 2381
123 Ga0395901_0640521 3300038443 Bacteria 1067
124 Ga0439461_0098553 3300041410 Bacteria 709
125 Ga0439465_0034340 3300041413 Bacteria 1624
126 Ga0451807_0605860 3300041486 Bacteria 1029
127 Ga0439431_0093698 3300041997 Bacteria 820
128 Ga0439455_0031411 3300042012 Bacteria 1322
129 Ga0450888_005479 3300042126 Bacteria 1356
130 Ga0450894_029629 3300042131 Bacteria 760
131 Ga0450898_010701 3300042134 Bacteria 1490
132 Ga0439446_0086549 3300042156 Bacteria 976
133 Ga0439434_0040933 3300042435 Bacteria 1423
134 Ga0451577_0000126 3300042876 Bacteria 168037
135 Ga0466969_0008846 3300044656 Bacteria 5340
136 Ga0466972_0611669 3300044658 Unclassified 515
137 Ga0466966_0190436 3300044684 Bacteria 1243
138 Ga0466966_0243993 3300044684 Bacteria 1082
139 Ga0466961_0006682 3300044693 Bacteria 7337
140 Ga0466970_0141277 3300044765 Bacteria 1326
141 Ga0466957_0115415 3300044842 Bacteria 1707
142 Ga0466957_0168102 3300044842 Bacteria 1427
143 Ga0466957_0585801 3300044842 Unclassified 780
144 Ga0466957_1118582 3300044842 Bacteria 568
145 Ga0466959_0007032 3300045049 Bacteria 7865
146 Ga0495663_0014491 3300046525 Bacteria 2210
147 Ga0495642_0027841 3300046528 Bacteria 2250
148 Ga0495621_0005872 3300046539 Bacteria 3554
149 Ga0495621_0014746 3300046539 Bacteria 2480
150 Ga0495633_0155576 3300046558 Bacteria 1055
151 Ga0495656_0025520 3300046615 Bacteria 2344
152 Ga0495668_0761282 3300046616 Unclassified 536
153 Ga0495588_0116213 3300046674 Unclassified 1410
154 Ga0495669_0208386 3300046684 Bacteria 935
155 Ga0495636_0075317 3300047318 Unclassified 1446
156 Ga0495636_0266125 3300047318 Bacteria 796
157 Ga0495677_0124704 3300047445 Bacteria 983
158 Ga0495685_021875 3300047447 Bacteria 2201
159 Ga0496104_1572734 3300048907 Bacteria 560
160 Ga0501320_028019 3300049536 Bacteria 688
161 Ga0501031_0529927 3300049568 Bacteria 759
162 Ga0501032_0564472 3300049569 Bacteria 725
163 Ga0501033_0737172 3300049570 Bacteria 669
164 Ga0501034_0032461 3300049571 Bacteria 5302
165 Ga0501036_0135382 3300049572 Bacteria 2080
166 Ga0501037_0157751 3300049573 Bacteria 1619
167 Ga0501038_0015146 3300049574 Bacteria 7016
168 Ga0501038_1027599 3300049574 Bacteria 604
169 Ga0501039_0277389 3300049575 Bacteria 1318
170 Ga0501039_1038506 3300049575 Bacteria 636
171 Ga0501043_0167743 3300049579 Bacteria 1714
172 Ga0501046_0055283 3300049580 Bacteria 3120
173 Ga0501047_0017579 3300049581 Bacteria 6851
174 Ga0501047_0451800 3300049581 Bacteria 1114
175 Ga0501048_1209060 3300049582 Bacteria 543
176 Ga0501073_0868240 3300049589 Bacteria 621
177 Ga0501243_078608 3300049675 Bacteria 638
178 Ga0501080_0008659 3300049742 Bacteria 9238
179 Ga0501080_1000450 3300049742 Bacteria 725
180 Ga0501263_043818 3300049760 Bacteria 664
181 Ga0501035_0072539 3300049822 Bacteria 3047
182 Ga0501035_0316775 3300049822 Bacteria 1311
183 Ga0501035_0480495 3300049822 Bacteria 1025
184 Ga0501044_0024976 3300049823 Bacteria 6335
185 Ga0501044_0038431 3300049823 Bacteria 4998
186 nmdc:mga00v17_1075113_c1 3300050491 Bacteria 504
187 nmdc:mga0yw44_18439_c1 3300050492 Bacteria 3823
188 nmdc:mga0yw44_249386_c1 3300050492 Bacteria 1181
189 nmdc:mga04h51_271816_c1 3300050495 Unclassified 684
190 nmdc:mga07m45_690186_c1 3300050496 Unclassified 587
191 nmdc:mga07m45_769683_c1 3300050496 Bacteria 552
192 Ga0500593_057112 3300053117 Bacteria 1722
193 Ga0500586_092423 3300053145 Bacteria 1062
194 Ga0500616_0036064 3300053153 Bacteria 2686
195 Ga0501084_0835475 3300054114 Unclassified 775
196 rootH1_10252738
197 JGI26128J50194_1000048
198 Ga0055540_1016395
199 Ga0055531_10000570
200 Ga0070670_101239510
201 Ga0070680_100176537
202 Ga0070660_100121502
203 Ga0070669_100487727
204 Ga0070669_100984673
205 Ga0070675_101088281
206 Ga0070671_101438113
207 Ga0070673_100382056
208 Ga0070659_101560927
209 Ga0070667_100657080
210 Ga0070714_100157428
211 Ga0070678_100077267
212 Ga0070681_11444021
213 Ga0070679_100003559
214 Ga0068855_100079539
215 Ga0068855_100313736
216 Ga0068855_100884119
217 Ga0068856_100418432
218 Ga0068856_101672067
219 Ga0068852_100528352
220 Ga0068852_101635094
221 Ga0068861_102114447
222 Ga0075365_10002081
223 Ga0075368_10251246
224 Ga0075363_100959322
225 Ga0075362_10117831
226 Ga0075362_10611829
227 Ga0097621_102322430
228 Ga0075370_10112639
229 Ga0105240_10166637
230 Ga0105241_10971626
231 Ga0105238_10110914
232 Ga0105249_11104754
233 Ga0105239_10170808
234 Ga0157378_10261038
235 Ga0163162_12938444
236 Ga0157380_10178469
237 Ga0157376_10000348
238 Ga0157376_10523646
239 Ga0209758_1092891
240 Ga0209051_1000055
241 Ga0209257_1000101
242 Ga0207705_10072707
243 Ga0207705_10711512
244 Ga0207705_11090800
245 Ga0207707_11142129
246 Ga0207695_10795478
247 Ga0207660_10097094
248 Ga0207652_10238059
249 Ga0207694_11268042
250 Ga0207650_10462726
251 Ga0207659_10153548
252 Ga0207659_10309173
253 Ga0207664_10590086
254 Ga0207644_10749801
255 Ga0207689_10190721
256 Ga0207667_10161164
257 Ga0207667_10674635
258 Ga0207658_11137336
259 Ga0207677_10005065
260 Ga0207702_10663427
261 Ga0207648_10473212
262 Ga0207675_101529778
263 Ga0207683_10074380
264 Ga0209981_1035120
265 Ga0209996_1000590
266 Ga0209995_1001999
267 Ga0209968_1000319
268 Ga0209999_1019679
269 Ga0209966_1000117
270 Ga0209974_10076080
271 Ga0307515_10042130
272 Ga0265331_10266874
273 Ga0307408_100176421
274 Ga0307408_100354408
275 Ga0307408_100556344
276 Ga0265314_10018936
277 Ga0265342_10055225
278 Ga0307405_11681650
279 Ga0307410_10712125
280 Ga0307406_11651492
281 Ga0307412_10257192
282 Ga0307412_11027497
283 Ga0307412_12002731
284 Ga0307409_100240994
285 Ga0307409_101379403
286 Ga0307416_100118110
287 Ga0307416_100264620
288 Ga0307416_100293830
289 Ga0307416_100457352
290 Ga0307414_10339743
291 Ga0307411_10242581
292 Ga0307415_100712396
293 Ga0395899_0010332
294 Ga0395899_0085207
295 Ga0395899_0632552
296 Ga0395900_0040063
297 Ga0395900_0141598
298 Ga0395900_0352277
299 Ga0395900_1317693
300 Ga0395898_0012139
301 Ga0395898_0044153
302 Ga0395898_0064104
303 Ga0395898_0278529
304 Ga0395905_0012984
305 Ga0395905_0055246
306 Ga0395905_0087244
307 Ga0395905_0160385
308 Ga0395905_0289957
309 Ga0395905_0480626
310 Ga0395905_0504171
311 Ga0395905_0914194
312 Ga0395905_1659828
313 Ga0395901_0048741
314 Ga0395901_0057646
315 Ga0395901_0101246
316 Ga0395901_0149656
317 Ga0395901_0158033
318 Ga0395901_0640521
319 Ga0439461_0098553
320 Ga0439465_0034340
321 Ga0451807_0605860
322 Ga0439431_0093698
323 Ga0439455_0031411
324 Ga0450888_005479
325 Ga0450894_029629
326 Ga0450898_010701
327 Ga0439446_0086549
328 Ga0439434_0040933
329 Ga0451577_0000126
330 Ga0466969_0008846
331 Ga0466972_0611669
332 Ga0466966_0190436
333 Ga0466966_0243993
334 Ga0466961_0006682
335 Ga0466970_0141277
336 Ga0466957_0115415
337 Ga0466957_0168102
338 Ga0466957_0585801
339 Ga0466957_1118582
340 Ga0466959_0007032
341 Ga0495663_0014491
342 Ga0495642_0027841
343 Ga0495621_0005872
344 Ga0495621_0014746
345 Ga0495633_0155576
346 Ga0495656_0025520
347 Ga0495668_0761282
348 Ga0495588_0116213
349 Ga0495669_0208386
350 Ga0495636_0075317
351 Ga0495636_0266125
352 Ga0495677_0124704
353 Ga0495685_021875
354 Ga0496104_1572734
355 Ga0501320_028019
356 Ga0501031_0529927
357 Ga0501032_0564472
358 Ga0501033_0737172
359 Ga0501034_0032461
360 Ga0501036_0135382
361 Ga0501037_0157751
362 Ga0501038_0015146
363 Ga0501038_1027599
364 Ga0501039_0277389
365 Ga0501039_1038506
366 Ga0501043_0167743
367 Ga0501046_0055283
368 Ga0501047_0017579
369 Ga0501047_0451800
370 Ga0501048_1209060
371 Ga0501073_0868240
372 Ga0501243_078608
373 Ga0501080_0008659
374 Ga0501080_1000450
375 Ga0501263_043818
376 Ga0501035_0072539
377 Ga0501035_0316775
378 Ga0501035_0480495
379 Ga0501044_0024976
380 Ga0501044_0038431
381 nmdc:mga00v17_1075113_c1
382 nmdc:mga0yw44_18439_c1
383 nmdc:mga0yw44_249386_c1
384 nmdc:mga04h51_271816_c1
385 nmdc:mga07m45_690186_c1
386 nmdc:mga07m45_769683_c1
387 Ga0500593_057112
388 Ga0500586_092423
389 Ga0500616_0036064
390 Ga0501084_0835475

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05437

AzlD

Branched-chain amino acid transport protein (AzlD)

19

117

0.99

Map