F299345

General Info

Members Datasets Scaffolds Average Seq Length
194 124 190 296

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0003994|Ga0500616_0003994_5643_6626
Length 327
Sequence LFKFSQERAAIQGFPRACPESEHLHSGRDKSMVDTFLKYLKYEKRYSPRTLVSYETDLRQFESHIKKEFESEPQDANYGMVRSWIVSLSQQKLESPSINRKIACLRSYFKFLRKREEISKDPMLKVKVLKSKKKLPSFINETELVGHLDRKVDDDDKRSEYQQKLDQAIIEMFYGTGMRRAELIGLRDRDINFNEHTVKVLGKRNKERIIPFSTGIVSILKEYREVRDREIERQDPEYFFLTGSGKKLYPELVYRIVKAILADLKIEKKSPHVMRHTYATHLLNKGAEINAVKDLLGHTSLAATQVYTHNTLEKLKEAYKAHPKSGH

Samples

Sample ID Description Type Environment
1 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
2 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
3 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
4 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
5 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
91 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
92 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
93 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
94 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
110 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
111 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
112 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
113 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
114 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
115 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
116 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
117 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
118 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
122 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.39
Metatranscriptomes 0.52
Isolates 3.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.46
Nodule 0
Rhizoplane 0.52
Rhizosphere 68.56
Stem 0
Stem Tuber 0
Unclassified 15.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1006251 3300001904 Bacteria 2007
2 JGI24739J22299_10026826 3300001989 Bacteria 2018
3 JGI24744J21845_10005025 3300002077 Bacteria 2738
4 JGI25162J39368_1001524 3300002737 Bacteria 11972
5 JGI25164J39214_1000824 3300002772 Bacteria 10827
6 JGI25152J39213_1000022 3300002773 Bacteria 105664
7 JGI25165J46597_1000923 3300003214 Bacteria 20349
8 rootH1_10000205 3300003316 Bacteria 21816
9 rootH1_10003147 3300003316 Bacteria 11413
10 rootH1_10198108 3300003316 Bacteria 1266
11 rootH2_10004559 3300003320 Bacteria 142332
12 rootL2_10002836 3300003322 Bacteria 16397
13 rootL2_10003603 3300003322 Bacteria 20915
14 rootL2_10041155 3300003322 Bacteria 7521
15 rootL2_10065233 3300003322 Bacteria 1562
16 rootL2_10075068 3300003322 Bacteria 2368
17 rootL2_10145500 3300003322 Bacteria 6254
18 rootL2_10160942 3300003322 Bacteria 3568
19 rootH1_10000619 3300003316 Bacteria 3651
20 rootH1_10000619 3300003323 Bacteria 100005
21 rootH1_10002814 3300003316 Bacteria 40375
22 rootH1_10002814 3300003323 Bacteria 12796
23 rootH1_10090725 3300003323 Bacteria 10775
24 rootH1_10104237 3300003323 Bacteria 3404
25 rootH1_10116243 3300003323 Bacteria 4523
26 rootH1_10130142 3300003323 Bacteria 1979
27 rootH1_10130143 3300003323 Bacteria 1821
28 rootH1_10175604 3300003323 Bacteria 1936
29 Ga0055536_1000001 3300003781 Bacteria 630663
30 Ga0055530_10005254 3300003791 Bacteria 6242
31 Ga0055531_10000169 3300003794 Bacteria 73302
32 Ga0058862_12850314 3300004803 Bacteria 1528
33 Ga0065165_1002847 3300005262 Bacteria 13435
34 Ga0065714_10009247 3300005288 Bacteria 2606
35 Ga0065714_10124444 3300005288 Bacteria 1311
36 Ga0070659_100053857 3300005366 Bacteria 3168
37 Ga0070662_100028795 3300005457 Bacteria 3869
38 Ga0070681_10008372 3300005458 Bacteria 10130
39 Ga0070679_100075612 3300005530 Bacteria 3357
40 Ga0070679_100252683 3300005530 Bacteria 1719
41 Ga0068855_100000026 3300005563 Bacteria 175140
42 Ga0068855_100000248 3300005563 Bacteria 67971
43 Ga0068855_100323950 3300005563 Bacteria 1703
44 Ga0068857_100306789 3300005577 Bacteria 1464
45 Ga0068856_100000014 3300005614 Bacteria 163480
46 Ga0068856_100166735 3300005614 Bacteria 2213
47 Ga0068864_100087078 3300005618 Bacteria 2749
48 Ga0070716_100046299 3300006173 Bacteria 2447
49 Ga0070712_100031327 3300006175 Unclassified 3582
50 Ga0075366_10000812 3300006195 Bacteria 14982
51 Ga0075366_10132436 3300006195 Bacteria 1505
52 Ga0075370_10215550 3300006353 Bacteria 1134
53 Ga0075428_100035126 3300006844 Bacteria 5526
54 Ga0075430_100249204 3300006846 Bacteria 1472
55 Ga0105240_10054975 3300009093 Bacteria 4986
56 Ga0105240_10300394 3300009093 Bacteria 1837
57 Ga0111539_10020892 3300009094 Bacteria 8061
58 Ga0111539_10049207 3300009094 Bacteria 5028
59 Ga0114129_10586740 3300009147 Unclassified 1445
60 Ga0105242_10113377 3300009176 Bacteria 2315
61 Ga0105237_10005754 3300009545 Bacteria 13929
62 Ga0105237_10114651 3300009545 Bacteria 2688
63 Ga0105239_10005053 3300010375 Bacteria 15586
64 Ga0105239_10016750 3300010375 Bacteria 8102
65 Ga0105246_10117626 3300011119 Bacteria 1964
66 Ga0157373_10024499 3300013100 Bacteria 4370
67 Ga0157370_10135449 3300013104 Bacteria 2296
68 Ga0157370_10179837 3300013104 Bacteria 1965
69 Ga0157370_10273007 3300013104 Bacteria 1562
70 Ga0157370_10342932 3300013104 Bacteria 1377
71 Ga0157370_10607104 3300013104 Bacteria 1001
72 Ga0157369_10000040 3300013105 Bacteria 183469
73 Ga0157369_10063032 3300013105 Bacteria 3994
74 Ga0157378_10007753 3300013297 Bacteria 9368
75 Ga0157372_10001280 3300013307 Bacteria 27216
76 Ga0157372_10087965 3300013307 Bacteria 3526
77 Ga0157372_10420806 3300013307 Bacteria 1557
78 Ga0157380_10000010 3300014326 Bacteria 140132
79 Ga0157380_10025389 3300014326 Bacteria 4494
80 Ga0182006_1012527 3300015261 Bacteria 3707
81 Ga0182007_10000003 3300015262 Bacteria 548244
82 Ga0163161_10291892 3300017792 Bacteria 1282
83 Ga0207427_100236 3300025231 Bacteria 45297
84 Ga0209437_100034 3300025233 Bacteria 494007
85 Ga0209233_1000038 3300025261 Bacteria 548972
86 Ga0209455_1002544 3300025272 Bacteria 6974
87 Ga0209676_1000008 3300025292 Bacteria 991778
88 Ga0209050_1000045 3300025298 Bacteria 388022
89 Ga0209050_1003908 3300025298 Bacteria 10560
90 Ga0209257_1000007 3300025304 Bacteria 1564415
91 Ga0207647_10064655 3300025904 Bacteria 2222
92 Ga0207707_10051151 3300025912 Bacteria 3598
93 Ga0207695_10000053 3300025913 Bacteria 396740
94 Ga0207695_10029659 3300025913 Bacteria 6038
95 Ga0207671_10022025 3300025914 Bacteria 4825
96 Ga0207671_10073712 3300025914 Bacteria 2550
97 Ga0207693_10136528 3300025915 Bacteria 1928
98 Ga0207652_10211357 3300025921 Bacteria 1747
99 Ga0207665_10061361 3300025939 Bacteria 2548
100 Ga0207667_10000022 3300025949 Bacteria 369570
101 Ga0207667_10001325 3300025949 Bacteria 31070
102 Ga0207702_10000036 3300026078 Bacteria 154106
103 Ga0207641_10483910 3300026088 Bacteria 1200
104 Ga0207674_10230867 3300026116 Bacteria 1798
105 Ga0207428_10033688 3300027907 Bacteria 4204
106 Ga0265318_10046122 3300028577 Unclassified 1646
107 Ga0265323_10000038 3300028653 Bacteria 70544
108 Ga0307515_10000514 3300028794 Bacteria 92292
109 Ga0307515_10060919 3300028794 Bacteria 5368
110 Ga0265338_10020274 3300028800 Bacteria 7005
111 Ga0265316_10000942 3300031344 Bacteria 31693
112 Ga0307513_10040454 3300031456 Bacteria 5154
113 Ga0307513_10239832 3300031456 Bacteria 1619
114 Ga0307513_10300017 3300031456 Bacteria 1374
115 Ga0307509_10054156 3300031507 Bacteria 4273
116 Ga0307509_10070446 3300031507 Bacteria 3651
117 Ga0307509_10189349 3300031507 Bacteria 1910
118 Ga0307408_100001786 3300031548 Bacteria 15706
119 Ga0316576_10009406 3300031727 Bacteria 6303
120 Ga0316576_10099257 3300031727 Bacteria 2175
121 Ga0307405_10000003 3300031731 Bacteria 569064
122 Ga0307405_10011188 3300031731 Bacteria 4687
123 Ga0307413_10118261 3300031824 Bacteria 1789
124 Ga0307410_10048504 3300031852 Bacteria 2845
125 Ga0307407_10000030 3300031903 Bacteria 97416
126 Ga0307409_100003848 3300031995 Bacteria 8287
127 Ga0307416_100000014 3300032002 Bacteria 249053
128 Ga0307416_100000694 3300032002 Bacteria 17494
129 Ga0307414_10030742 3300032004 Bacteria 3512
130 Ga0307414_10128774 3300032004 Bacteria 1961
131 Ga0307415_100004053 3300032126 Bacteria 7557
132 Ga0316574_0035072 3300035398 Bacteria 3064
133 Ga0316582_0005819 3300036647 Bacteria 6406
134 Ga0316584_0000096 3300036712 Bacteria 35816
135 Ga0451793_0793441 3300041452 Bacteria 1182
136 Ga0450893_0013065 3300042532 Bacteria 1382
137 Ga0451577_0008600 3300042876 Bacteria 9925
138 Ga0451577_0238978 3300042876 Bacteria 1643
139 Ga0451577_0648238 3300042876 Bacteria 958
140 Ga0453683_0105992 3300044673 Unclassified 1766
141 Ga0466964_0015042 3300044706 Bacteria 2948
142 Ga0453684_0000779 3300044712 Bacteria 109902
143 Ga0453684_0001540 3300044712 Bacteria 64408
144 Ga0453684_0001891 3300044712 Bacteria 54349
145 Ga0453684_0004538 3300044712 Bacteria 29114
146 Ga0453684_0009255 3300044712 Bacteria 17298
147 Ga0453684_0028641 3300044712 Bacteria 7938
148 Ga0453684_0064802 3300044712 Bacteria 4664
149 Ga0453684_0213995 3300044712 Bacteria 2238
150 Ga0453684_0755203 3300044712 Viruses 1052
151 Ga0451576_0000003 3300045051 Bacteria 1550573
152 Ga0451576_0004977 3300045051 Bacteria 16907
153 Ga0451576_0032976 3300045051 Bacteria 5507
154 Ga0451576_0053668 3300045051 Bacteria 4221
155 Ga0451576_0079825 3300045051 Bacteria 3405
156 Ga0451576_0101000 3300045051 Bacteria 3000
157 Ga0451576_0446705 3300045051 Bacteria 1357
158 Ga0495592_0112603 3300046454 Bacteria 1923
159 Ga0495638_0000004 3300046460 Bacteria 700795
160 Ga0495638_0086721 3300046460 Bacteria 1892
161 Ga0495653_0268834 3300046463 Bacteria 1124
162 Ga0495606_0009373 3300046507 Bacteria 8289
163 Ga0495610_0002826 3300046512 Bacteria 14145
164 Ga0495652_0038339 3300046529 Bacteria 4152
165 Ga0495634_0113055 3300046642 Bacteria 1744
166 Ga0495625_0062112 3300046660 Bacteria 2641
167 Ga0495625_0089409 3300046660 Bacteria 2132
168 Ga0495600_0176142 3300046809 Bacteria 1379
169 Ga0495660_0022461 3300046810 Bacteria 3603
170 Ga0501300_003138 3300049523 Bacteria 2463
171 Ga0501202_010995 3300049652 Bacteria 1689
172 Ga0501217_010737 3300049661 Bacteria 2013
173 Ga0501217_049079 3300049661 Bacteria 1098
174 Ga0501247_003370 3300049677 Bacteria 1712
175 Ga0501257_000316 3300049686 Bacteria 9346
176 Ga0501225_0015876 3300049705 Bacteria 2093
177 Ga0501264_000261 3300049761 Bacteria 8343
178 nmdc:mga0k408_783_c1 3300050493 Bacteria 17509
179 nmdc:mga07m45_60240_c1 3300050496 Bacteria 2148
180 nmdc:mga05p37_696598_c1 3300050507 Bacteria 1129
181 nmdc:mga08y16_207434_c1 3300050511 Bacteria 2030
182 Ga0500562_006263 3300053108 Bacteria 3001
183 Ga0500655_011427 3300053133 Bacteria 1609
184 Ga0500655_015536 3300053133 Unclassified 1397
185 Ga0500616_0000015 3300053153 Bacteria 633259
186 Ga0500616_0003994 3300053153 Bacteria 10770
187 Ga0500616_0016375 3300053153 Bacteria 4220
188 Ga0500622_0000418 3300053156 Bacteria 40378
189 Ga0500622_0000421 3300053156 Bacteria 40169
190 Ga0500622_0003743 3300053156 Bacteria 9939

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_0793441 Ga0451793_0793441_80_820 239
2 3300046460 Ga0495638_0086721 Ga0495638_0086721_354_1130 250
3 3300046463 Ga0495653_0268834 Ga0495653_0268834_245_1066 264
4 3300013104 Ga0157370_10273007 Ga0157370_102730072 268
5 3300013307 Ga0157372_10001280 Ga0157372_1000128024 276
6 3300028800 Ga0265338_10020274 Ga0265338_1002027412 276
7 3300003323 rootH1_10130143 rootH1_101301433 283
8 3300044712 Ga0453684_0000779 Ga0453684_0000779_19041_19919 283
9 3300044712 Ga0453684_0755203 Ga0453684_0755203_34_912 283
10 3300003781 Ga0055536_1000001 Ga0055536_1000001445 284
11 3300003791 Ga0055530_10005254 Ga0055530_100052549 284
12 3300025292 Ga0209676_1000008 Ga0209676_1000008416 284
13 3300025298 Ga0209050_1000045 Ga0209050_1000045369 284
14 3300013104 Ga0157370_10607104 Ga0157370_106071041 285
15 3300003322 rootL2_10041155 rootL2_100411555 288
16 3300003794 Ga0055531_10000169 Ga0055531_100001698 288
17 3300004803 Ga0058862_12850314 Ga0058862_128503141 288
18 3300005458 Ga0070681_10008372 Ga0070681_100083727 288
19 3300005530 Ga0070679_100075612 Ga0070679_1000756122 288
20 3300025304 Ga0209257_1000007 Ga0209257_10000071133 288
21 3300025912 Ga0207707_10051151 Ga0207707_100511515 288
22 iso_pu_bacteria 2842722452 2842725189 289
23 iso_pu_bacteria 2842909656 2842912463 289
24 iso_pu_bacteria 2857627736 2857629744 289
25 3300002737 JGI25162J39368_1001524 JGI25162J39368_100152416 290
26 3300002772 JGI25164J39214_1000824 JGI25164J39214_10008243 290
27 3300003214 JGI25165J46597_1000923 JGI25165J46597_10009233 290
28 3300003323 rootH1_10090725 rootH1_1009072510 290
29 3300006175 Ga0070712_100031327 Ga0070712_1000313274 290
30 3300013104 Ga0157370_10179837 Ga0157370_101798372 290
31 3300025231 Ga0207427_100236 Ga0207427_1002364 290
32 3300025233 Ga0209437_100034 Ga0209437_1000343 290
33 3300025261 Ga0209233_1000038 Ga0209233_10000383 290
34 3300025915 Ga0207693_10136528 Ga0207693_101365283 290
35 3300031456 Ga0307513_10239832 Ga0307513_102398322 290
36 3300031507 Ga0307509_10070446 Ga0307509_100704461 290
37 3300053153 Ga0500616_0003994 Ga0500616_0003994_5643_6626 290
38 iso_pu_bacteria 2852623160 2852625303 290
39 iso_pu_bacteria 2884933994 2884934316 290
40 3300003316 rootH1_10000205 rootH1_1000020524 291
41 3300003320 rootH2_10004559 rootH2_1000455929 291
42 3300003322 rootL2_10002836 rootL2_1000283616 291
43 3300003322 rootL2_10003603 rootL2_100036038 291
44 3300003322 rootL2_10160942 rootL2_101609423 291
45 3300003323 rootH1_10104237 rootH1_101042373 291
46 3300003323 rootH1_10175604 rootH1_101756043 291
47 3300005262 Ga0065165_1002847 Ga0065165_10028476 291
48 3300005618 Ga0068864_100087078 Ga0068864_1000870783 291
49 3300006173 Ga0070716_100046299 Ga0070716_1000462992 291
50 3300009094 Ga0111539_10020892 Ga0111539_100208924 291
51 3300013297 Ga0157378_10007753 Ga0157378_100077535 291
52 3300014326 Ga0157380_10025389 Ga0157380_100253892 291
53 3300025939 Ga0207665_10061361 Ga0207665_100613612 291
54 3300026088 Ga0207641_10483910 Ga0207641_104839102 291
55 3300027907 Ga0207428_10033688 Ga0207428_100336884 291
56 3300031507 Ga0307509_10189349 Ga0307509_101893493 291
57 3300042876 Ga0451577_0648238 Ga0451577_0648238_11_904 291
58 3300044673 Ga0453683_0105992 Ga0453683_0105992_452_1342 291
59 3300044712 Ga0453684_0009255 Ga0453684_0009255_13005_13886 291
60 3300044712 Ga0453684_0028641 Ga0453684_0028641_6252_7133 291
61 3300045051 Ga0451576_0032976 Ga0451576_0032976_572_1453 291
62 3300046454 Ga0495592_0112603 Ga0495592_0112603_940_1821 291
63 3300046642 Ga0495634_0113055 Ga0495634_0113055_735_1616 291
64 3300046809 Ga0495600_0176142 Ga0495600_0176142_284_1165 291
65 3300053133 Ga0500655_011427 Ga0500655_011427_162_1052 291
66 3300053133 Ga0500655_015536 Ga0500655_015536_155_1033 291
67 3300053153 Ga0500616_0016375 Ga0500616_0016375_2306_3184 291
68 3300053156 Ga0500622_0000418 Ga0500622_0000418_34313_35191 291
69 3300053156 Ga0500622_0003743 Ga0500622_0003743_1740_2618 291
70 iso_pu_bacteria 2919437846 2919438202 291
71 3300003316 rootH1_10003147 rootH1_100031473 292
72 3300003322 rootL2_10075068 rootL2_100750682 292
73 3300003322 rootL2_10145500 rootL2_101455002 292
74 3300003323 rootH1_10000619 rootH1_1000061941 292
75 3300003323 rootH1_10002814 rootH1_100028143 292
76 3300003323 rootH1_10130142 rootH1_101301422 292
77 3300006844 Ga0075428_100035126 Ga0075428_1000351264 292
78 3300006846 Ga0075430_100249204 Ga0075430_1002492041 292
79 3300009094 Ga0111539_10049207 Ga0111539_100492075 292
80 3300009147 Ga0114129_10586740 Ga0114129_105867402 292
81 3300009176 Ga0105242_10113377 Ga0105242_101133773 292
82 3300013307 Ga0157372_10420806 Ga0157372_104208062 292
83 3300025298 Ga0209050_1003908 Ga0209050_10039086 292
84 3300028577 Ga0265318_10046122 Ga0265318_100461222 292
85 3300028794 Ga0307515_10000514 Ga0307515_1000051453 292
86 3300028794 Ga0307515_10060919 Ga0307515_100609196 292
87 3300031456 Ga0307513_10040454 Ga0307513_100404541 292
88 3300031456 Ga0307513_10300017 Ga0307513_103000172 292
89 3300031548 Ga0307408_100001786 Ga0307408_10000178611 292
90 3300031727 Ga0316576_10009406 Ga0316576_100094069 292
91 3300031731 Ga0307405_10011188 Ga0307405_100111885 292
92 3300031824 Ga0307413_10118261 Ga0307413_101182611 292
93 3300031852 Ga0307410_10048504 Ga0307410_100485043 292
94 3300031995 Ga0307409_100003848 Ga0307409_1000038487 292
95 3300032002 Ga0307416_100000694 Ga0307416_10000069410 292
96 3300032004 Ga0307414_10030742 Ga0307414_100307424 292
97 3300032126 Ga0307415_100004053 Ga0307415_1000040534 292
98 3300035398 Ga0316574_0035072 Ga0316574_0035072_703_1587 292
99 3300042532 Ga0450893_0013065 Ga0450893_0013065_271_1152 292
100 3300042876 Ga0451577_0008600 Ga0451577_0008600_7717_8601 292
101 3300042876 Ga0451577_0238978 Ga0451577_0238978_493_1380 292
102 3300044706 Ga0466964_0015042 Ga0466964_0015042_416_1312 292
103 3300044712 Ga0453684_0001540 Ga0453684_0001540_56_937 292
104 3300044712 Ga0453684_0001891 Ga0453684_0001891_37597_38481 292
105 3300044712 Ga0453684_0004538 Ga0453684_0004538_245_1129 292
106 3300044712 Ga0453684_0064802 Ga0453684_0064802_53_937 292
107 3300044712 Ga0453684_0213995 Ga0453684_0213995_495_1382 292
108 3300045051 Ga0451576_0000003 Ga0451576_0000003_864178_865080 292
109 3300045051 Ga0451576_0004977 Ga0451576_0004977_14184_15065 292
110 3300045051 Ga0451576_0053668 Ga0451576_0053668_141_1022 292
111 3300045051 Ga0451576_0079825 Ga0451576_0079825_1197_2078 292
112 3300045051 Ga0451576_0101000 Ga0451576_0101000_671_1558 292
113 3300045051 Ga0451576_0446705 Ga0451576_0446705_340_1224 292
114 3300046460 Ga0495638_0000004 Ga0495638_0000004_236198_237079 292
115 3300049523 Ga0501300_003138 Ga0501300_003138_1541_2422 292
116 3300049661 Ga0501217_010737 Ga0501217_010737_647_1528 292
117 3300049661 Ga0501217_049079 Ga0501217_049079_49_930 292
118 3300049677 Ga0501247_003370 Ga0501247_003370_16_897 292
119 3300049686 Ga0501257_000316 Ga0501257_000316_5729_6628 292
120 3300049705 Ga0501225_0015876 Ga0501225_0015876_787_1686 292
121 3300050507 nmdc:mga05p37_696598_c1 nmdc:mga05p37_696598_c1_196_1077 292
122 3300050511 nmdc:mga08y16_207434_c1 nmdc:mga08y16_207434_c1_959_1840 292
123 3300053108 Ga0500562_006263 Ga0500562_006263_333_1274 292
124 3300053153 Ga0500616_0000015 Ga0500616_0000015_590490_591371 292
125 3300053156 Ga0500622_0000421 Ga0500622_0000421_5186_6133 292
126 3300002773 JGI25152J39213_1000022 JGI25152J39213_100002237 293
127 3300003316 rootH1_10198108 rootH1_101981081 293
128 3300003322 rootL2_10065233 rootL2_100652331 293
129 3300003323 rootH1_10116243 rootH1_101162433 293
130 3300005288 Ga0065714_10009247 Ga0065714_100092474 293
131 3300005288 Ga0065714_10124444 Ga0065714_101244442 293
132 3300006195 Ga0075366_10132436 Ga0075366_101324363 293
133 3300013100 Ga0157373_10024499 Ga0157373_100244994 293
134 3300013104 Ga0157370_10135449 Ga0157370_101354496 293
135 3300013104 Ga0157370_10342932 Ga0157370_103429322 293
136 3300013105 Ga0157369_10000040 Ga0157369_10000040172 293
137 3300013307 Ga0157372_10087965 Ga0157372_100879653 293
138 3300014326 Ga0157380_10000010 Ga0157380_1000001051 293
139 3300015261 Ga0182006_1012527 Ga0182006_10125277 293
140 3300015262 Ga0182007_10000003 Ga0182007_10000003445 293
141 3300017792 Ga0163161_10291892 Ga0163161_102918922 293
142 3300028653 Ga0265323_10000038 Ga0265323_1000003840 293
143 3300031344 Ga0265316_10000942 Ga0265316_1000094222 293
144 3300031727 Ga0316576_10099257 Ga0316576_100992575 293
145 3300031731 Ga0307405_10000003 Ga0307405_10000003228 293
146 3300031903 Ga0307407_10000030 Ga0307407_1000003023 293
147 3300032002 Ga0307416_100000014 Ga0307416_10000001440 293
148 3300032004 Ga0307414_10128774 Ga0307414_101287742 293
149 3300036647 Ga0316582_0005819 Ga0316582_0005819_934_1821 293
150 3300036712 Ga0316584_0000096 Ga0316584_0000096_12917_13804 293
151 3300046512 Ga0495610_0002826 Ga0495610_0002826_2536_3420 293
152 3300049652 Ga0501202_010995 Ga0501202_010995_515_1411 293
153 3300049761 Ga0501264_000261 Ga0501264_000261_6846_7742 293
154 3300050493 nmdc:mga0k408_783_c1 nmdc:mga0k408_783_c1_495_1379 293
155 3300006353 Ga0075370_10215550 Ga0075370_102155502 294
156 3300050496 nmdc:mga07m45_60240_c1 nmdc:mga07m45_60240_c1_971_1858 294
157 3300001904 JGI24736J21556_1006251 JGI24736J21556_10062512 295
158 3300001989 JGI24739J22299_10026826 JGI24739J22299_100268264 295
159 3300002077 JGI24744J21845_10005025 JGI24744J21845_100050257 295
160 3300005366 Ga0070659_100053857 Ga0070659_1000538572 295
161 3300005457 Ga0070662_100028795 Ga0070662_1000287957 295
162 3300005530 Ga0070679_100252683 Ga0070679_1002526832 295
163 3300005563 Ga0068855_100000026 Ga0068855_10000002617 295
164 3300005563 Ga0068855_100000248 Ga0068855_10000024810 295
165 3300005563 Ga0068855_100323950 Ga0068855_1003239502 295
166 3300005577 Ga0068857_100306789 Ga0068857_1003067892 295
167 3300005614 Ga0068856_100000014 Ga0068856_10000001416 295
168 3300005614 Ga0068856_100166735 Ga0068856_1001667352 295
169 3300006195 Ga0075366_10000812 Ga0075366_1000081212 295
170 3300009093 Ga0105240_10054975 Ga0105240_100549755 295
171 3300009093 Ga0105240_10300394 Ga0105240_103003941 295
172 3300009545 Ga0105237_10005754 Ga0105237_1000575415 295
173 3300009545 Ga0105237_10114651 Ga0105237_101146513 295
174 3300010375 Ga0105239_10005053 Ga0105239_1000505311 295
175 3300010375 Ga0105239_10016750 Ga0105239_100167507 295
176 3300011119 Ga0105246_10117626 Ga0105246_101176263 295
177 3300013105 Ga0157369_10063032 Ga0157369_100630326 295
178 3300025272 Ga0209455_1002544 Ga0209455_10025445 295
179 3300025904 Ga0207647_10064655 Ga0207647_100646552 295
180 3300025913 Ga0207695_10000053 Ga0207695_10000053169 295
181 3300025913 Ga0207695_10029659 Ga0207695_100296592 295
182 3300025914 Ga0207671_10022025 Ga0207671_100220254 295
183 3300025914 Ga0207671_10073712 Ga0207671_100737126 295
184 3300025921 Ga0207652_10211357 Ga0207652_102113572 295
185 3300025949 Ga0207667_10000022 Ga0207667_10000022156 295
186 3300025949 Ga0207667_10001325 Ga0207667_1000132529 295
187 3300026078 Ga0207702_10000036 Ga0207702_10000036118 295
188 3300026116 Ga0207674_10230867 Ga0207674_102308672 295
189 3300031507 Ga0307509_10054156 Ga0307509_100541566 295
190 3300046507 Ga0495606_0009373 Ga0495606_0009373_5424_6335 295
191 3300046529 Ga0495652_0038339 Ga0495652_0038339_1057_1971 295
192 3300046660 Ga0495625_0062112 Ga0495625_0062112_1548_2459 295
193 3300046660 Ga0495625_0089409 Ga0495625_0089409_381_1295 295
194 3300046810 Ga0495660_0022461 Ga0495660_0022461_2147_3058 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00589

Phage_integrase

Phage integrase family

151

314

0.95

PF02899

Phage_int_SAM_1

Phage integrase, N-terminal SAM-like domain

33

116

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrw-assembly1.cif.gz_A crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a 0.872 2 100
2oxo-assembly1.cif.gz_A crystallization and structure determination of the core-binding domain of bacteriophage lambda integrase 0.8575 2 95
2kob-assembly1.cif.gz_A solution nmr structure of clolep_01837 (fragment 61-160) from clostridium leptum. northeast structural genomics consortium target qlr8a 0.8484 2 101
2kd1-assembly1.cif.gz_A solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f 0.8171 2 102
2oxo-assembly1.cif.gz_A crystallization and structure determination of the core-binding domain of bacteriophage lambda integrase 0.8083 2 95
ID Description Score Start End Superfamily
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9364 2 95 1.10.150.130
af_Q2FY74_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9303 2 94 1.10.150.130
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9082 2 95 1.10.150.130
af_Q2FY74_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.8934 2 94 1.10.150.130
af_P9WF33_5_106_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.8903 2 94 1.10.150.130
ID Description Score Start End GO Terms
AF-A0A381I8U0-F1-model_v4 Tyrosine recombinase 0.913 132 229 GO:0003677
GO:0006310
GO:0015074
AF-X1IKC8-F1-model_v4 Tyr recombinase domain-containing protein 0.9094 106 230 GO:0003677
GO:0006310
GO:0015074
AF-A0A7S4A9F3-F1-model_v4 Tyr recombinase domain-containing protein 0.8985 95 262 GO:0003677
GO:0006310
GO:0015074
AF-X0ZSM2-F1-model_v4 Tyr recombinase domain-containing protein 0.8949 113 268 GO:0003677
GO:0006310
GO:0015074
AF-A0A7S4A9F3-F1-model_v4 Tyr recombinase domain-containing protein 0.893 95 262 GO:0003677
GO:0006310
GO:0015074

Feature Viewer

pLDDT pTM Quality
79.34 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map