F299327

General Info

Members Datasets Scaffolds Average Seq Length
194 118 388 242

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_234064_c1|nmdc:mga0a205_234064_c1_218_1042
Length 274
Sequence MPAAPHEHTAYRPRIGAISIDLTGKAALVTGAASGIGRAIAEDLASRGARVLLADIDEIALRAVAGPLEGAIAQRADISSRDDCRAIVERARREWGGVDILVNNAGLQHVAPIEEFPEDRWEYLVRVMLVGAFLLTKYALPDMYRKRWGRIVNISSLHGLVASPYKSAYVAAKHGLMGLTKTIALEAADKGVTANAVCPSYVRTPLVEKQIADQARLNNMSESDVIEKVMLAPAAIKRLLEPSEVAAYVAFLCCDEASGITGSSQVIDMGWTAR

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
98 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
99 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 1.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.22
Rhizosphere 82.99
Stem 0
Stem Tuber 0
Unclassified 2.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_234064_c1 3300050515 Bacteria 1719
2 Ga0065715_10090945 3300005293 Bacteria 6289
3 Ga0070680_100001123 3300005336 Bacteria 19231
4 Ga0070680_100010259 3300005336 Bacteria 7220
5 Ga0070660_100179823 3300005339 Bacteria 1711
6 Ga0070692_10004128 3300005345 Bacteria 6006
7 Ga0070659_100034309 3300005366 Bacteria 3947
8 Ga0070703_10008460 3300005406 Bacteria 2894
9 Ga0070709_10013805 3300005434 Unclassified 4552
10 Ga0070710_10189986 3300005437 Bacteria 1291
11 Ga0070705_100059970 3300005440 Bacteria 2255
12 Ga0070694_100005590 3300005444 Bacteria 7617
13 Ga0070694_100010214 3300005444 Bacteria 5781
14 Ga0070694_100093527 3300005444 Bacteria 2113
15 Ga0070708_100003050 3300005445 Bacteria 13007
16 Ga0070708_100004084 3300005445 Bacteria 11469
17 Ga0070708_100008311 3300005445 Bacteria 8335
18 Ga0070708_100021351 3300005445 Bacteria 5473
19 Ga0070708_100090067 3300005445 Bacteria 2792
20 Ga0070708_100144910 3300005445 Bacteria 2205
21 Ga0070681_10104427 3300005458 Bacteria 2776
22 Ga0070681_10106029 3300005458 Bacteria 2752
23 Ga0070706_100008715 3300005467 Bacteria 9453
24 Ga0070706_100039768 3300005467 Bacteria 4340
25 Ga0070706_100101636 3300005467 Bacteria 2672
26 Ga0070707_100030466 3300005468 Bacteria 5137
27 Ga0070707_100133257 3300005468 Bacteria 2417
28 Ga0070698_100034415 3300005471 Bacteria 5243
29 Ga0070698_100178700 3300005471 Bacteria 2061
30 Ga0070698_100264775 3300005471 Bacteria 1651
31 Ga0070698_100304363 3300005471 Bacteria 1525
32 Ga0070698_100320188 3300005471 Bacteria 1481
33 Ga0070698_100320206 3300005471 Bacteria 1481
34 Ga0070698_100469337 3300005471 Bacteria 1195
35 Ga0070699_100028931 3300005518 Bacteria 4777
36 Ga0070699_100081468 3300005518 Bacteria 2821
37 Ga0070699_100129298 3300005518 Bacteria 2226
38 Ga0070679_100135144 3300005530 Bacteria 2447
39 Ga0070679_100273438 3300005530 Bacteria 1643
40 Ga0070684_100062148 3300005535 Bacteria 3271
41 Ga0070697_100100681 3300005536 Bacteria 2400
42 Ga0070697_100448776 3300005536 Bacteria 1123
43 Ga0068853_100223914 3300005539 Bacteria 1719
44 Ga0070686_100163267 3300005544 Bacteria 1570
45 Ga0070695_100014172 3300005545 Bacteria 4803
46 Ga0070695_100022916 3300005545 Bacteria 3833
47 Ga0070695_100204427 3300005545 Bacteria 1414
48 Ga0070696_100074568 3300005546 Bacteria 2393
49 Ga0070704_100078923 3300005549 Bacteria 2416
50 Ga0068856_100014583 3300005614 Bacteria 7594
51 Ga0068870_10384562 3300005840 Bacteria 909
52 Ga0081540_1028274 3300005983 Bacteria 3153
53 Ga0075428_100045494 3300006844 Bacteria 4822
54 Ga0075431_100077816 3300006847 Bacteria 3423
55 Ga0075433_10020977 3300006852 Bacteria 5473
56 Ga0075433_10443002 3300006852 Bacteria 1145
57 Ga0075434_100000563 3300006871 Bacteria 28523
58 Ga0068865_100091479 3300006881 Bacteria 2208
59 Ga0068865_100560238 3300006881 Bacteria 961
60 Ga0075436_100014364 3300006914 Bacteria 5420
61 Ga0075436_100045541 3300006914 Bacteria 3026
62 Ga0097620_100286920 3300006931 Bacteria 1739
63 Ga0075435_100000820 3300007076 Bacteria 19375
64 Ga0075435_100062207 3300007076 Bacteria 3029
65 Ga0075435_100184075 3300007076 Bacteria 1766
66 Ga0111539_10078821 3300009094 Bacteria 3874
67 Ga0111539_10343612 3300009094 Bacteria 1737
68 Ga0105245_10153032 3300009098 Bacteria 2183
69 Ga0105241_10208305 3300009174 Bacteria 1637
70 Ga0157370_10192030 3300013104 Bacteria 1895
71 Ga0157378_10472599 3300013297 Bacteria 1248
72 Ga0157372_10503088 3300013307 Bacteria 1413
73 Ga0206356_10859833 3300020070 Bacteria 1906
74 Ga0206353_11912503 3300020082 Bacteria 1674
75 Ga0213872_10039453 3300021361 Bacteria 2155
76 Ga0213876_10001252 3300021384 Bacteria 16048
77 Ga0213876_10002627 3300021384 Bacteria 10500
78 Ga0213876_10004357 3300021384 Bacteria 7925
79 Ga0213876_10012585 3300021384 Bacteria 4501
80 Ga0213876_10093836 3300021384 Bacteria 1590
81 Ga0213876_10118567 3300021384 Bacteria 1405
82 Ga0207653_10000885 3300025885 Bacteria 9945
83 Ga0207643_10396526 3300025908 Bacteria 872
84 Ga0207705_10014437 3300025909 Bacteria 5685
85 Ga0207705_10081530 3300025909 Bacteria 2358
86 Ga0207684_10000009 3300025910 Bacteria 572126
87 Ga0207684_10045364 3300025910 Bacteria 3729
88 Ga0207684_10237642 3300025910 Bacteria 1572
89 Ga0207684_10263445 3300025910 Bacteria 1487
90 Ga0207684_10460047 3300025910 Bacteria 1092
91 Ga0207707_10006994 3300025912 Bacteria 9842
92 Ga0207660_10011622 3300025917 Bacteria 5740
93 Ga0207660_10021041 3300025917 Bacteria 4383
94 Ga0207660_10237168 3300025917 Bacteria 1436
95 Ga0207660_10374833 3300025917 Unclassified 1143
96 Ga0207657_10004031 3300025919 Bacteria 15601
97 Ga0207657_10045399 3300025919 Bacteria 3857
98 Ga0207649_10124575 3300025920 Bacteria 1742
99 Ga0207652_10075092 3300025921 Bacteria 2945
100 Ga0207652_10095824 3300025921 Bacteria 2614
101 Ga0207652_10372703 3300025921 Bacteria 1289
102 Ga0207646_10000176 3300025922 Bacteria 86757
103 Ga0207646_10030928 3300025922 Bacteria 4849
104 Ga0207646_10175257 3300025922 Bacteria 1937
105 Ga0207690_10022952 3300025932 Bacteria 3888
106 Ga0207686_10552125 3300025934 Bacteria 901
107 Ga0207661_10363836 3300025944 Bacteria 1307
108 Ga0207708_10139892 3300026075 Bacteria 1898
109 Ga0207675_100083359 3300026118 Bacteria 2998
110 Ga0207698_10363851 3300026142 Bacteria 1371
111 Ga0268265_10378023 3300028380 Bacteria 1302
112 Ga0316575_10004537 3300031665 Bacteria 4888
113 Ga0316576_10040704 3300031727 Bacteria 3341
114 Ga0316578_10024554 3300031728 Bacteria 3382
115 Ga0307413_10021784 3300031824 Bacteria 3440
116 Ga0307406_10379138 3300031901 Bacteria 1114
117 Ga0307409_100091283 3300031995 Bacteria 2496
118 Ga0307415_100073636 3300032126 Bacteria 2411
119 Ga0316583_10001056 3300032133 Bacteria 8921
120 Ga0373943_0224048 3300035170 Bacteria 1048
121 Ga0373955_0237525 3300035172 Bacteria 1091
122 Ga0316574_0116961 3300035398 Unclassified 1710
123 Ga0373935_0010613 3300035692 Bacteria 5528
124 Ga0373927_0274862 3300035695 Bacteria 1108
125 Ga0373937_0052224 3300036401 Bacteria 3747
126 Ga0316582_0000854 3300036647 Bacteria 12414
127 Ga0373925_0213413 3300037068 Bacteria 1538
128 Ga0395898_0265006 3300037466 Bacteria 1639
129 Ga0316581_0001631 3300037588 Bacteria 5131
130 Ga0436364_0354092 3300037853 Bacteria 8974
131 Ga0436364_0652976 3300037853 Bacteria 903
132 Ga0436364_0705105 3300037853 Bacteria 4417
133 Ga0436364_0795696 3300037853 Bacteria 6147
134 Ga0436364_1498018 3300037853 Bacteria 1175
135 Ga0395901_0617551 3300038443 Bacteria 1091
136 Ga0436365_0502628 3300039437 Bacteria 3451
137 Ga0436365_0546417 3300039437 Bacteria 2987
138 Ga0436365_0844975 3300039437 Bacteria 10380
139 Ga0436365_0865107 3300039437 Bacteria 2580
140 Ga0436365_1095781 3300039437 Bacteria 20796
141 Ga0436365_1396340 3300039437 Bacteria 77105
142 Ga0436365_1399627 3300039437 Bacteria 7222
143 Ga0436360_0801189 3300039438 Bacteria 1217
144 Ga0436360_0947026 3300039438 Bacteria 1610
145 Ga0436360_1063082 3300039438 Bacteria 4721
146 Ga0436360_1084081 3300039438 Bacteria 2949
147 Ga0436360_1209699 3300039438 Bacteria 5173
148 Ga0436361_0022673 3300039447 Bacteria 4314
149 Ga0436361_0137381 3300039447 Bacteria 1553
150 Ga0436361_0245162 3300039447 Bacteria 4450
151 Ga0436361_0663039 3300039447 Bacteria 5268
152 Ga0436361_0920957 3300039447 Bacteria 7481
153 Ga0436363_1404448 3300039450 Bacteria 14422
154 Ga0439435_0015094 3300042436 Bacteria 1918
155 Ga0466972_0038538 3300044658 Bacteria 2334
156 Ga0453683_0104829 3300044673 Bacteria 1776
157 Ga0466965_0116595 3300044683 Bacteria 1376
158 Ga0466963_0084265 3300044694 Bacteria 2156
159 Ga0466957_0097646 3300044842 Bacteria 1848
160 Ga0466959_0222590 3300045049 Bacteria 1308
161 Ga0451576_0012325 3300045051 Bacteria 9613
162 Ga0451576_0073034 3300045051 Bacteria 3570
163 Ga0466967_0459216 3300045976 Bacteria 1246
164 Ga0466967_0644533 3300045976 Bacteria 1047
165 Ga0495656_0201506 3300046615 Bacteria 988
166 Ga0495636_0048858 3300047318 Bacteria 1769
167 Ga0495615_0017839 3300048090 Bacteria 1553
168 Ga0496100_0125157 3300048903 Bacteria 1803
169 Ga0496100_0456012 3300048903 Unclassified 981
170 Ga0496100_0492825 3300048903 Bacteria 943
171 Ga0496101_0012201 3300048904 Bacteria 5729
172 Ga0496101_0090823 3300048904 Bacteria 2272
173 Ga0496103_0628019 3300048906 Bacteria 683
174 Ga0496107_0034358 3300048910 Bacteria 3632
175 Ga0496107_0097744 3300048910 Bacteria 2150
176 Ga0496112_0025018 3300048915 Bacteria 5728
177 Ga0496112_0037990 3300048915 Bacteria 4701
178 Ga0496112_0358412 3300048915 Bacteria 1401
179 Ga0496113_0075162 3300048916 Bacteria 2578
180 Ga0496114_0185253 3300048917 Bacteria 1819
181 Ga0496115_0016690 3300048918 Bacteria 5597
182 Ga0501034_0012624 3300049571 Bacteria 8718
183 Ga0501067_0015437 3300049583 Bacteria 4229
184 Ga0501070_0142961 3300049586 Bacteria 1975
185 Ga0501073_0221037 3300049589 Bacteria 1308
186 Ga0501074_0050804 3300049590 Bacteria 2993
187 Ga0501080_0021653 3300049742 Bacteria 5952
188 nmdc:mga05p37_31961_c1 3300050507 Bacteria 6435
189 nmdc:mga08y16_312893_c1 3300050511 Bacteria 1617
190 nmdc:mga08y16_72997_c1 3300050511 Bacteria 3576
191 nmdc:mga08x19_20608_c1 3300050514 Bacteria 4060
192 nmdc:mga0a205_378495_c1 3300050515 Bacteria 1281
193 Ga0501084_0271108 3300054114 Bacteria 1433
194 Ga0466962_0296454 3300061719 Bacteria 799
195 nmdc:mga0a205_234064_c1
196 Ga0065715_10090945
197 Ga0070680_100001123
198 Ga0070680_100010259
199 Ga0070660_100179823
200 Ga0070692_10004128
201 Ga0070659_100034309
202 Ga0070703_10008460
203 Ga0070709_10013805
204 Ga0070710_10189986
205 Ga0070705_100059970
206 Ga0070694_100005590
207 Ga0070694_100010214
208 Ga0070694_100093527
209 Ga0070708_100003050
210 Ga0070708_100004084
211 Ga0070708_100008311
212 Ga0070708_100021351
213 Ga0070708_100090067
214 Ga0070708_100144910
215 Ga0070681_10104427
216 Ga0070681_10106029
217 Ga0070706_100008715
218 Ga0070706_100039768
219 Ga0070706_100101636
220 Ga0070707_100030466
221 Ga0070707_100133257
222 Ga0070698_100034415
223 Ga0070698_100178700
224 Ga0070698_100264775
225 Ga0070698_100304363
226 Ga0070698_100320188
227 Ga0070698_100320206
228 Ga0070698_100469337
229 Ga0070699_100028931
230 Ga0070699_100081468
231 Ga0070699_100129298
232 Ga0070679_100135144
233 Ga0070679_100273438
234 Ga0070684_100062148
235 Ga0070697_100100681
236 Ga0070697_100448776
237 Ga0068853_100223914
238 Ga0070686_100163267
239 Ga0070695_100014172
240 Ga0070695_100022916
241 Ga0070695_100204427
242 Ga0070696_100074568
243 Ga0070704_100078923
244 Ga0068856_100014583
245 Ga0068870_10384562
246 Ga0081540_1028274
247 Ga0075428_100045494
248 Ga0075431_100077816
249 Ga0075433_10020977
250 Ga0075433_10443002
251 Ga0075434_100000563
252 Ga0068865_100091479
253 Ga0068865_100560238
254 Ga0075436_100014364
255 Ga0075436_100045541
256 Ga0097620_100286920
257 Ga0075435_100000820
258 Ga0075435_100062207
259 Ga0075435_100184075
260 Ga0111539_10078821
261 Ga0111539_10343612
262 Ga0105245_10153032
263 Ga0105241_10208305
264 Ga0157370_10192030
265 Ga0157378_10472599
266 Ga0157372_10503088
267 Ga0206356_10859833
268 Ga0206353_11912503
269 Ga0213872_10039453
270 Ga0213876_10001252
271 Ga0213876_10002627
272 Ga0213876_10004357
273 Ga0213876_10012585
274 Ga0213876_10093836
275 Ga0213876_10118567
276 Ga0207653_10000885
277 Ga0207643_10396526
278 Ga0207705_10014437
279 Ga0207705_10081530
280 Ga0207684_10000009
281 Ga0207684_10045364
282 Ga0207684_10237642
283 Ga0207684_10263445
284 Ga0207684_10460047
285 Ga0207707_10006994
286 Ga0207660_10011622
287 Ga0207660_10021041
288 Ga0207660_10237168
289 Ga0207660_10374833
290 Ga0207657_10004031
291 Ga0207657_10045399
292 Ga0207649_10124575
293 Ga0207652_10075092
294 Ga0207652_10095824
295 Ga0207652_10372703
296 Ga0207646_10000176
297 Ga0207646_10030928
298 Ga0207646_10175257
299 Ga0207690_10022952
300 Ga0207686_10552125
301 Ga0207661_10363836
302 Ga0207708_10139892
303 Ga0207675_100083359
304 Ga0207698_10363851
305 Ga0268265_10378023
306 Ga0316575_10004537
307 Ga0316576_10040704
308 Ga0316578_10024554
309 Ga0307413_10021784
310 Ga0307406_10379138
311 Ga0307409_100091283
312 Ga0307415_100073636
313 Ga0316583_10001056
314 Ga0373943_0224048
315 Ga0373955_0237525
316 Ga0316574_0116961
317 Ga0373935_0010613
318 Ga0373927_0274862
319 Ga0373937_0052224
320 Ga0316582_0000854
321 Ga0373925_0213413
322 Ga0395898_0265006
323 Ga0316581_0001631
324 Ga0436364_0354092
325 Ga0436364_0652976
326 Ga0436364_0705105
327 Ga0436364_0795696
328 Ga0436364_1498018
329 Ga0395901_0617551
330 Ga0436365_0502628
331 Ga0436365_0546417
332 Ga0436365_0844975
333 Ga0436365_0865107
334 Ga0436365_1095781
335 Ga0436365_1396340
336 Ga0436365_1399627
337 Ga0436360_0801189
338 Ga0436360_0947026
339 Ga0436360_1063082
340 Ga0436360_1084081
341 Ga0436360_1209699
342 Ga0436361_0022673
343 Ga0436361_0137381
344 Ga0436361_0245162
345 Ga0436361_0663039
346 Ga0436361_0920957
347 Ga0436363_1404448
348 Ga0439435_0015094
349 Ga0466972_0038538
350 Ga0453683_0104829
351 Ga0466965_0116595
352 Ga0466963_0084265
353 Ga0466957_0097646
354 Ga0466959_0222590
355 Ga0451576_0012325
356 Ga0451576_0073034
357 Ga0466967_0459216
358 Ga0466967_0644533
359 Ga0495656_0201506
360 Ga0495636_0048858
361 Ga0495615_0017839
362 Ga0496100_0125157
363 Ga0496100_0456012
364 Ga0496100_0492825
365 Ga0496101_0012201
366 Ga0496101_0090823
367 Ga0496103_0628019
368 Ga0496107_0034358
369 Ga0496107_0097744
370 Ga0496112_0025018
371 Ga0496112_0037990
372 Ga0496112_0358412
373 Ga0496113_0075162
374 Ga0496114_0185253
375 Ga0496115_0016690
376 Ga0501034_0012624
377 Ga0501067_0015437
378 Ga0501070_0142961
379 Ga0501073_0221037
380 Ga0501074_0050804
381 Ga0501080_0021653
382 nmdc:mga05p37_31961_c1
383 nmdc:mga08y16_312893_c1
384 nmdc:mga08y16_72997_c1
385 nmdc:mga08x19_20608_c1
386 nmdc:mga0a205_378495_c1
387 Ga0501084_0271108
388 Ga0466962_0296454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

25

215

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

31

272

0.91

PF08659

KR

KR domain

26

197

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zzq-assembly1.cif.gz_A crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and acetoacetate 0.9233 1 229
6zzq-assembly1.cif.gz_A crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and acetoacetate 0.9195 1 229
6zzo-assembly2.cif.gz_C crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate 0.9143 1 226
6zzs-assembly2.cif.gz_F-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and 3-oxovalerate 0.9099 1 229
6zzo-assembly2.cif.gz_D-3 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate 0.9072 1 226
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9416 4 35 3.50.50.60
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9207 1 96 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9169 4 80 3.40.50.720
af_K7MUD1_29_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9079 3 80 3.40.50.720
2rhcB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9077 4 225 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W6BV71-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9648 2 120 GO:0016020
GO:0016491
AF-A0A2W6CLF8-F1-model_v4 Oxidoreductase 0.962 4 126 GO:0016020
GO:0016491
AF-A0A7W6HBN4-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9558 2 135 GO:0016491
AF-A0A520EZT1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9544 1 137
AF-A0A3M0ZME2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9535 1 120 GO:0016491

Map