F298920

General Info

Members Datasets Scaffolds Average Seq Length
194 112 388 270

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0120342|Ga0373927_0120342_694_1590
Length 298
Sequence MAITDKLTIWSDFFSLPPQRIACYKLPMATPLKIGFLGAGKMATALARGFVNARLVKANQLLAADPFDAARKHFAADTGAKTVTANLDVAKNANVLVLATKPDQVAGALAEISGVFTKNHLLISIAAGVTLAKLEGHLPAGARVIRVMPNTPALVGAGASGFALGKNATAADGELAKKLLSAVGIALPVKESLLDAVTGLSGSGPAYVYQFIEALSDGGVAAGLPREVATKLAAQTVLGGAKMVLDTGIHPGALKDQVTSPGGTTIEGLHELEKGKLRATVMSAVRAATDKSKKLGQG

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
27 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
38 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
39 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
40 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
41 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
42 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
48 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
49 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
56 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
57 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
58 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
59 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
60 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
61 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
62 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
63 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
64 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
65 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
66 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
67 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 1.03
Rhizosphere 97.94
Stem 0
Stem Tuber 0
Unclassified 11.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0120342 3300035695 Bacteria 1713
2 Ga0070690_100002796 3300005330 Bacteria 9419
3 Ga0068869_100586547 3300005334 Bacteria 940
4 Ga0070689_100018525 3300005340 Bacteria 5131
5 Ga0070691_10180206 3300005341 Bacteria 1100
6 Ga0070688_100075463 3300005365 Bacteria 2167
7 Ga0070667_100017153 3300005367 Bacteria 5997
8 Ga0070711_100060058 3300005439 Bacteria 2642
9 Ga0070705_100179385 3300005440 Bacteria 1433
10 Ga0070686_100001517 3300005544 Bacteria 13043
11 Ga0070686_100017054 3300005544 Bacteria 4237
12 Ga0070686_100137964 3300005544 Bacteria 1694
13 Ga0070704_100008703 3300005549 Bacteria 6104
14 Ga0068855_100053352 3300005563 Bacteria 4757
15 Ga0068856_100018549 3300005614 Bacteria 6743
16 Ga0068856_100268594 3300005614 Bacteria 1721
17 Ga0068859_100027777 3300005617 Bacteria 5675
18 Ga0068859_100239264 3300005617 Bacteria 1904
19 Ga0068859_100381458 3300005617 Bacteria 1505
20 Ga0068863_100065136 3300005841 Bacteria 3447
21 Ga0075362_10139034 3300006177 Bacteria 1160
22 Ga0075431_100148139 3300006847 Unclassified 2417
23 Ga0097620_100027777 3300006931 Bacteria 5675
24 Ga0097620_100239271 3300006931 Bacteria 1904
25 Ga0097620_100381472 3300006931 Bacteria 1505
26 Ga0105240_10124478 3300009093 Bacteria 3100
27 Ga0105240_10138836 3300009093 Bacteria 2908
28 Ga0111539_10678214 3300009094 Unclassified 1200
29 Ga0111539_10790977 3300009094 Bacteria 1104
30 Ga0105242_10065889 3300009176 Bacteria 2990
31 Ga0105248_10069858 3300009177 Bacteria 3944
32 Ga0105238_10153602 3300009551 Bacteria 2277
33 Ga0157370_10034043 3300013104 Bacteria 4964
34 Ga0157370_10035689 3300013104 Bacteria 4830
35 Ga0163163_10084094 3300014325 Bacteria 3188
36 Ga0163163_10533419 3300014325 Bacteria 1236
37 Ga0213872_10029296 3300021361 Bacteria 2524
38 Ga0207663_10003010 3300025916 Bacteria 8152
39 Ga0207694_10164193 3300025924 Bacteria 1795
40 Ga0207686_10070424 3300025934 Bacteria 2247
41 Ga0207667_10030029 3300025949 Bacteria 5885
42 Ga0207658_10007287 3300025986 Bacteria 7543
43 Ga0207703_10132624 3300026035 Bacteria 2153
44 Ga0207702_10003162 3300026078 Bacteria 15239
45 Ga0207702_10215481 3300026078 Bacteria 1787
46 Ga0207641_10322120 3300026088 Bacteria 1466
47 Ga0207676_10143346 3300026095 Bacteria 2048
48 Ga0207674_10388289 3300026116 Unclassified 1349
49 Ga0265337_1000299 3300028556 Bacteria 26474
50 Ga0265337_1007981 3300028556 Bacteria 3898
51 Ga0265319_1000007 3300028563 Bacteria 217194
52 Ga0265319_1024855 3300028563 Bacteria 2150
53 Ga0265319_1039738 3300028563 Bacteria 1593
54 Ga0265334_10055992 3300028573 Unclassified 1499
55 Ga0265318_10025547 3300028577 Bacteria 2332
56 Ga0265318_10028219 3300028577 Bacteria 2197
57 Ga0265323_10008909 3300028653 Bacteria 4121
58 Ga0265323_10027797 3300028653 Unclassified 2123
59 Ga0265323_10029630 3300028653 Bacteria 2046
60 Ga0265336_10000543 3300028666 Bacteria 21601
61 Ga0265336_10011413 3300028666 Bacteria 3022
62 Ga0265338_10000008 3300028800 Bacteria 481542
63 Ga0265338_10000269 3300028800 Bacteria 95081
64 Ga0265338_10000395 3300028800 Bacteria 78200
65 Ga0265338_10000431 3300028800 Bacteria 75210
66 Ga0265338_10001287 3300028800 Bacteria 41160
67 Ga0265338_10001734 3300028800 Bacteria 34498
68 Ga0265338_10002195 3300028800 Bacteria 29897
69 Ga0265338_10002454 3300028800 Bacteria 27760
70 Ga0265338_10010506 3300028800 Bacteria 10840
71 Ga0265338_10018518 3300028800 Bacteria 7451
72 Ga0265338_10029204 3300028800 Bacteria 5473
73 Ga0265338_10050130 3300028800 Bacteria 3777
74 Ga0265338_10054137 3300028800 Unclassified 3582
75 Ga0265338_10057633 3300028800 Bacteria 3435
76 Ga0265338_10075145 3300028800 Bacteria 2869
77 Ga0265338_10099964 3300028800 Bacteria 2367
78 Ga0265338_10210773 3300028800 Bacteria 1458
79 Ga0265338_10244858 3300028800 Bacteria 1326
80 Ga0265338_10281573 3300028800 Unclassified 1215
81 Ga0265324_10000322 3300029957 Bacteria 35202
82 Ga0265324_10000906 3300029957 Bacteria 18776
83 Ga0265324_10007056 3300029957 Unclassified 4607
84 Ga0265324_10007656 3300029957 Bacteria 4350
85 Ga0265324_10012799 3300029957 Bacteria 3150
86 Ga0265324_10021465 3300029957 Unclassified 2315
87 Ga0265332_10132704 3300031238 Eukaryota 1045
88 Ga0265320_10008545 3300031240 Bacteria 6260
89 Ga0265320_10023803 3300031240 Bacteria 3251
90 Ga0265325_10009235 3300031241 Bacteria 5766
91 Ga0265325_10016588 3300031241 Bacteria 4115
92 Ga0265325_10028449 3300031241 Bacteria 3013
93 Ga0265325_10064266 3300031241 Bacteria 1855
94 Ga0265340_10001884 3300031247 Bacteria 11946
95 Ga0265340_10035357 3300031247 Bacteria 2481
96 Ga0265340_10092029 3300031247 Bacteria 1416
97 Ga0265339_10002645 3300031249 Bacteria 12772
98 Ga0265327_10001053 3300031251 Bacteria 38592
99 Ga0265316_10006713 3300031344 Bacteria 10964
100 Ga0265316_10013419 3300031344 Bacteria 7281
101 Ga0265316_10032931 3300031344 Bacteria 4226
102 Ga0265316_10075811 3300031344 Unclassified 2585
103 Ga0265316_10215103 3300031344 Bacteria 1420
104 Ga0265316_10217648 3300031344 Bacteria 1410
105 Ga0265316_10473430 3300031344 Bacteria 897
106 Ga0265313_10005680 3300031595 Bacteria 9105
107 Ga0265313_10012426 3300031595 Bacteria 5198
108 Ga0265314_10018120 3300031711 Bacteria 5502
109 Ga0265314_10024305 3300031711 Bacteria 4596
110 Ga0265314_10042930 3300031711 Bacteria 3220
111 Ga0265342_10035589 3300031712 Bacteria 3047
112 Ga0373930_0014638 3300034816 Bacteria 1463
113 Ga0373928_0000238 3300035084 Bacteria 10821
114 Ga0373929_0000272 3300035085 Bacteria 9567
115 Ga0373944_0000012 3300035089 Bacteria 34389
116 Ga0373944_0116696 3300035089 Unclassified 916
117 Ga0373951_0001368 3300035091 Bacteria 6410
118 Ga0373932_0000001 3300035112 Bacteria 1459067
119 Ga0373939_0024522 3300035114 Bacteria 1681
120 Ga0373945_0001631 3300035116 Bacteria 6876
121 Ga0373945_0063651 3300035116 Bacteria 1381
122 Ga0373954_0013913 3300035118 Bacteria 3586
123 Ga0373956_0194220 3300035119 Bacteria 961
124 Ga0373946_0173965 3300035171 Bacteria 1018
125 Ga0316574_0054756 3300035398 Bacteria 2492
126 Ga0316574_0204957 3300035398 Unclassified 1266
127 Ga0373931_0000008 3300035691 Bacteria 362269
128 Ga0373931_0070937 3300035691 Unclassified 1902
129 Ga0373931_0206402 3300035691 Unclassified 1176
130 Ga0373935_0003764 3300035692 Bacteria 8857
131 Ga0373935_0005966 3300035692 Bacteria 7228
132 Ga0373927_0003325 3300035695 Bacteria 11571
133 Ga0373927_0038290 3300035695 Bacteria 3113
134 Ga0373927_0432937 3300035695 Bacteria 868
135 Ga0373947_0022281 3300035725 Bacteria 3672
136 Ga0373947_0050638 3300035725 Bacteria 2497
137 Ga0373937_0227800 3300036401 Bacteria 1755
138 Ga0373925_0000158 3300037068 Bacteria 72961
139 Ga0373925_0003646 3300037068 Bacteria 11865
140 Ga0373925_0026459 3300037068 Bacteria 4244
141 Ga0395905_0055362 3300037471 Unclassified 3712
142 Ga0436360_1109886 3300039438 Bacteria 4952
143 Ga0436361_0548446 3300039447 Bacteria 5571
144 Ga0436362_0507859 3300039453 Bacteria 14131
145 Ga0451577_0205296 3300042876 Bacteria 1779
146 Ga0453684_0024315 3300044712 Bacteria 8860
147 Ga0451576_0157084 3300045051 Bacteria 2373
148 Ga0451576_0203094 3300045051 Bacteria 2070
149 Ga0451576_0309137 3300045051 Unclassified 1654
150 Ga0495641_0033291 3300046461 Bacteria 2448
151 Ga0495651_0172685 3300046462 Bacteria 1538
152 Ga0495664_0170802 3300046477 Unclassified 1319
153 Ga0495608_0320540 3300046511 Unclassified 958
154 Ga0495628_0236419 3300046516 Bacteria 1368
155 Ga0495628_0279244 3300046516 Bacteria 1241
156 Ga0495630_0104646 3300046517 Bacteria 2142
157 Ga0495666_0023083 3300046526 Bacteria 3078
158 Ga0495640_0011352 3300046533 Bacteria 6858
159 Ga0495640_0040875 3300046533 Bacteria 3244
160 Ga0495586_0002437 3300046535 Bacteria 10094
161 Ga0495586_0244576 3300046535 Unclassified 1023
162 Ga0495645_0023977 3300046543 Unclassified 4423
163 Ga0495645_0415040 3300046543 Bacteria 855
164 Ga0495667_0041832 3300046559 Bacteria 3038
165 Ga0495634_0016984 3300046642 Bacteria 5199
166 Ga0495658_0006541 3300046683 Bacteria 5725
167 Ga0495658_0049706 3300046683 Bacteria 2369
168 Ga0495613_0066365 3300046689 Bacteria 2635
169 Ga0495613_0277624 3300046689 Bacteria 1164
170 Ga0495624_0208373 3300046690 Bacteria 1186
171 Ga0495600_0313906 3300046809 Bacteria 987
172 Ga0495674_0101301 3300047319 Unclassified 2450
173 Ga0495676_0230235 3300047321 Bacteria 1273
174 Ga0496112_0380008 3300048915 Unclassified 1354
175 Ga0496115_0044360 3300048918 Bacteria 3546
176 Ga0501031_0000113 3300049568 Bacteria 43219
177 Ga0501031_0055725 3300049568 Bacteria 2576
178 Ga0501032_0001671 3300049569 Bacteria 17620
179 Ga0501033_0007884 3300049570 Bacteria 8251
180 Ga0501033_0045488 3300049570 Bacteria 3266
181 Ga0501037_0063715 3300049573 Bacteria 2687
182 Ga0501037_0084795 3300049573 Bacteria 2294
183 Ga0501039_0253684 3300049575 Bacteria 1383
184 Ga0501043_0050265 3300049579 Bacteria 3277
185 Ga0501070_0205378 3300049586 Bacteria 1618
186 Ga0501243_032195 3300049675 Bacteria 899
187 Ga0501083_0090788 3300049744 Bacteria 2017
188 Ga0501035_0003627 3300049822 Bacteria 14724
189 Ga0501035_0090813 3300049822 Bacteria 2688
190 Ga0501044_0000792 3300049823 Bacteria 38210
191 Ga0501044_0027356 3300049823 Bacteria 6028
192 nmdc:mga03683_281752_c1 3300050489 Bacteria 777
193 nmdc:mga06r32_148262_c1 3300050510 Unclassified 2324
194 Ga0495601_0055610 3300053077 Bacteria 2506
195 Ga0373927_0120342
196 Ga0070690_100002796
197 Ga0068869_100586547
198 Ga0070689_100018525
199 Ga0070691_10180206
200 Ga0070688_100075463
201 Ga0070667_100017153
202 Ga0070711_100060058
203 Ga0070705_100179385
204 Ga0070686_100001517
205 Ga0070686_100017054
206 Ga0070686_100137964
207 Ga0070704_100008703
208 Ga0068855_100053352
209 Ga0068856_100018549
210 Ga0068856_100268594
211 Ga0068859_100027777
212 Ga0068859_100239264
213 Ga0068859_100381458
214 Ga0068863_100065136
215 Ga0075362_10139034
216 Ga0075431_100148139
217 Ga0097620_100027777
218 Ga0097620_100239271
219 Ga0097620_100381472
220 Ga0105240_10124478
221 Ga0105240_10138836
222 Ga0111539_10678214
223 Ga0111539_10790977
224 Ga0105242_10065889
225 Ga0105248_10069858
226 Ga0105238_10153602
227 Ga0157370_10034043
228 Ga0157370_10035689
229 Ga0163163_10084094
230 Ga0163163_10533419
231 Ga0213872_10029296
232 Ga0207663_10003010
233 Ga0207694_10164193
234 Ga0207686_10070424
235 Ga0207667_10030029
236 Ga0207658_10007287
237 Ga0207703_10132624
238 Ga0207702_10003162
239 Ga0207702_10215481
240 Ga0207641_10322120
241 Ga0207676_10143346
242 Ga0207674_10388289
243 Ga0265337_1000299
244 Ga0265337_1007981
245 Ga0265319_1000007
246 Ga0265319_1024855
247 Ga0265319_1039738
248 Ga0265334_10055992
249 Ga0265318_10025547
250 Ga0265318_10028219
251 Ga0265323_10008909
252 Ga0265323_10027797
253 Ga0265323_10029630
254 Ga0265336_10000543
255 Ga0265336_10011413
256 Ga0265338_10000008
257 Ga0265338_10000269
258 Ga0265338_10000395
259 Ga0265338_10000431
260 Ga0265338_10001287
261 Ga0265338_10001734
262 Ga0265338_10002195
263 Ga0265338_10002454
264 Ga0265338_10010506
265 Ga0265338_10018518
266 Ga0265338_10029204
267 Ga0265338_10050130
268 Ga0265338_10054137
269 Ga0265338_10057633
270 Ga0265338_10075145
271 Ga0265338_10099964
272 Ga0265338_10210773
273 Ga0265338_10244858
274 Ga0265338_10281573
275 Ga0265324_10000322
276 Ga0265324_10000906
277 Ga0265324_10007056
278 Ga0265324_10007656
279 Ga0265324_10012799
280 Ga0265324_10021465
281 Ga0265332_10132704
282 Ga0265320_10008545
283 Ga0265320_10023803
284 Ga0265325_10009235
285 Ga0265325_10016588
286 Ga0265325_10028449
287 Ga0265325_10064266
288 Ga0265340_10001884
289 Ga0265340_10035357
290 Ga0265340_10092029
291 Ga0265339_10002645
292 Ga0265327_10001053
293 Ga0265316_10006713
294 Ga0265316_10013419
295 Ga0265316_10032931
296 Ga0265316_10075811
297 Ga0265316_10215103
298 Ga0265316_10217648
299 Ga0265316_10473430
300 Ga0265313_10005680
301 Ga0265313_10012426
302 Ga0265314_10018120
303 Ga0265314_10024305
304 Ga0265314_10042930
305 Ga0265342_10035589
306 Ga0373930_0014638
307 Ga0373928_0000238
308 Ga0373929_0000272
309 Ga0373944_0000012
310 Ga0373944_0116696
311 Ga0373951_0001368
312 Ga0373932_0000001
313 Ga0373939_0024522
314 Ga0373945_0001631
315 Ga0373945_0063651
316 Ga0373954_0013913
317 Ga0373956_0194220
318 Ga0373946_0173965
319 Ga0316574_0054756
320 Ga0316574_0204957
321 Ga0373931_0000008
322 Ga0373931_0070937
323 Ga0373931_0206402
324 Ga0373935_0003764
325 Ga0373935_0005966
326 Ga0373927_0003325
327 Ga0373927_0038290
328 Ga0373927_0432937
329 Ga0373947_0022281
330 Ga0373947_0050638
331 Ga0373937_0227800
332 Ga0373925_0000158
333 Ga0373925_0003646
334 Ga0373925_0026459
335 Ga0395905_0055362
336 Ga0436360_1109886
337 Ga0436361_0548446
338 Ga0436362_0507859
339 Ga0451577_0205296
340 Ga0453684_0024315
341 Ga0451576_0157084
342 Ga0451576_0203094
343 Ga0451576_0309137
344 Ga0495641_0033291
345 Ga0495651_0172685
346 Ga0495664_0170802
347 Ga0495608_0320540
348 Ga0495628_0236419
349 Ga0495628_0279244
350 Ga0495630_0104646
351 Ga0495666_0023083
352 Ga0495640_0011352
353 Ga0495640_0040875
354 Ga0495586_0002437
355 Ga0495586_0244576
356 Ga0495645_0023977
357 Ga0495645_0415040
358 Ga0495667_0041832
359 Ga0495634_0016984
360 Ga0495658_0006541
361 Ga0495658_0049706
362 Ga0495613_0066365
363 Ga0495613_0277624
364 Ga0495624_0208373
365 Ga0495600_0313906
366 Ga0495674_0101301
367 Ga0495676_0230235
368 Ga0496112_0380008
369 Ga0496115_0044360
370 Ga0501031_0000113
371 Ga0501031_0055725
372 Ga0501032_0001671
373 Ga0501033_0007884
374 Ga0501033_0045488
375 Ga0501037_0063715
376 Ga0501037_0084795
377 Ga0501039_0253684
378 Ga0501043_0050265
379 Ga0501070_0205378
380 Ga0501243_032195
381 Ga0501083_0090788
382 Ga0501035_0003627
383 Ga0501035_0090813
384 Ga0501044_0000792
385 Ga0501044_0027356
386 nmdc:mga03683_281752_c1
387 nmdc:mga06r32_148262_c1
388 Ga0495601_0055610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14748

P5CR_dimer

Pyrroline-5-carboxylate reductase dimerisation

191

295

0.98

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

33

128

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bsh-assembly1.cif.gz_G crystal structure of medicago truncatula (delta)1-pyrroline-5-carboxylate reductase (mtp5cr) in complex with l-proline 0.9619 10 276
5bse-assembly1.cif.gz_A crystal structure of medicago truncatula (delta)1-pyrroline-5-carboxylate reductase (mtp5cr) 0.9599 10 276
5bsh-assembly1.cif.gz_D crystal structure of medicago truncatula (delta)1-pyrroline-5-carboxylate reductase (mtp5cr) in complex with l-proline 0.9586 10 276
5bsh-assembly1.cif.gz_G crystal structure of medicago truncatula (delta)1-pyrroline-5-carboxylate reductase (mtp5cr) in complex with l-proline 0.9512 10 276
3gt0-assembly1.cif.gz_A crystal structure of pyrroline 5-carboxylate reductase from bacillus cereus. northeast structural genomics consortium target bcr38b 0.944 12 230
ID Description Score Start End Superfamily
af_Q53H96_3_169_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9882 13 173 3.40.50.720
af_Q21544_1_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9643 14 172 3.40.50.720
af_E9AGK4_1_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9608 12 173 3.40.50.720
af_P0A9L8_1_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9575 13 172 3.40.50.720
5bshG01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9536 10 177 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Y1HSV0-F1-model_v4 Pyrroline-5-carboxylate reductase (EC 1.5.1.2) 0.9834 13 277 GO:0004735
GO:0055129
AF-A0A3A6MPW4-F1-model_v4 Pyrroline-5-carboxylate reductase (P5C reductase) (P5CR) (EC 1.5.1.2) (PCA reductase) 0.9823 13 275 GO:0004735
GO:0005737
GO:0016020
GO:0055129
AF-A0A7S1TMK9-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9802 13 182 GO:0004735
GO:0055129
AF-A0A4U3AU36-F1-model_v4 deleted 0.98 13 117
AF-A0A7C3DWC9-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9789 13 187 GO:0004735
GO:0055129

Map