F298706

General Info

Members Datasets Scaffolds Average Seq Length
194 119 388 156

Family's Representative Sequence

Representative Sequence 3300020082|Ga0206353_10087137|Ga0206353_100871372
Length 173
Sequence MFSARARERQGTEMATPSQAPHRAYAGIMSTFAGGLGAAVLLGKALGRDPAEHGPLDLAVLCAATFKAARTISGDEVASFIRQPFVEGEAHAGGEDPVETGDLRQAIGELVTCSRCIGTWVAGGLTVTQMIAPQFGRMLTWSLAAAGVNDYLQAGFAALTNKSNELEQRVGEP

Samples

Sample ID Description Type Environment
1 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
62 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
63 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
66 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
77 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
83 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
87 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
90 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
95 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
96 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
117 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 1.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 8.76
Rhizosphere 86.6
Stem 0
Stem Tuber 0
Unclassified 11.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206353_10087137 3300020082 Bacteria 1787
2 Ga0070658_10011730 3300005327 Bacteria 7030
3 Ga0070658_10036922 3300005327 Bacteria 3938
4 Ga0070658_10066379 3300005327 Bacteria 2947
5 Ga0070658_10482953 3300005327 Bacteria 1069
6 Ga0070658_10575050 3300005327 Bacteria 976
7 Ga0070683_100141827 3300005329 Bacteria 2276
8 Ga0068869_100239937 3300005334 Bacteria 1444
9 Ga0070680_100061889 3300005336 Bacteria 3064
10 Ga0070660_100019375 3300005339 Bacteria 4985
11 Ga0070660_100110114 3300005339 Bacteria 2190
12 Ga0070660_100148891 3300005339 Bacteria 1881
13 Ga0070660_100683822 3300005339 Bacteria 860
14 Ga0070659_100166684 3300005366 Bacteria 1803
15 Ga0070659_100310703 3300005366 Unclassified 1316
16 Ga0070714_100023572 3300005435 Bacteria 5059
17 Ga0070714_100800606 3300005435 Bacteria 913
18 Ga0070714_100944355 3300005435 Bacteria 838
19 Ga0070701_10435362 3300005438 Unclassified 838
20 Ga0070711_100174181 3300005439 Unclassified 1642
21 Ga0070705_100511508 3300005440 Bacteria 913
22 Ga0070708_101174845 3300005445 Unclassified 718
23 Ga0070681_10062178 3300005458 Bacteria 3708
24 Ga0070681_10086252 3300005458 Bacteria 3092
25 Ga0070681_10759299 3300005458 Bacteria 886
26 Ga0070685_10097877 3300005466 Bacteria 1786
27 Ga0070679_100080075 3300005530 Bacteria 3256
28 Ga0070679_100108539 3300005530 Bacteria 2761
29 Ga0070684_100058717 3300005535 Bacteria 3362
30 Ga0068853_100434499 3300005539 Bacteria 1233
31 Ga0068853_101418451 3300005539 Unclassified 672
32 Ga0070696_101246895 3300005546 Unclassified 629
33 Ga0070693_100495634 3300005547 Bacteria 866
34 Ga0070693_100736908 3300005547 Bacteria 725
35 Ga0070664_101536114 3300005564 Bacteria 630
36 Ga0068852_101632578 3300005616 Bacteria 667
37 Ga0081455_10119851 3300005937 Bacteria 2074
38 Ga0070717_10708496 3300006028 Bacteria 915
39 Ga0075365_10129188 3300006038 Unclassified 1748
40 Ga0105240_10388366 3300009093 Bacteria 1575
41 Ga0105237_10923575 3300009545 Bacteria 880
42 Ga0105237_11844100 3300009545 Unclassified 612
43 Ga0105239_10009163 3300010375 Bacteria 11195
44 Ga0157371_10528893 3300013102 Bacteria 873
45 Ga0157369_10063316 3300013105 Bacteria 3985
46 Ga0157369_10807383 3300013105 Bacteria 964
47 Ga0157369_11407466 3300013105 Unclassified 710
48 Ga0157374_10455774 3300013296 Bacteria 1280
49 Ga0157372_10729431 3300013307 Bacteria 1152
50 Ga0157375_10182186 3300013308 Bacteria 2252
51 Ga0206356_11666439 3300020070 Bacteria 1958
52 Ga0206350_11099700 3300020080 Bacteria 872
53 Ga0213876_10028697 3300021384 Bacteria 2934
54 Ga0213875_10131660 3300021388 Bacteria 1170
55 Ga0207699_10813674 3300025906 Bacteria 687
56 Ga0207705_10125635 3300025909 Bacteria 1906
57 Ga0207705_10558276 3300025909 Bacteria 890
58 Ga0207707_10072614 3300025912 Bacteria 3000
59 Ga0207707_10150652 3300025912 Bacteria 2034
60 Ga0207695_10441965 3300025913 Bacteria 1184
61 Ga0207660_10096984 3300025917 Bacteria 2196
62 Ga0207660_10696881 3300025917 Bacteria 828
63 Ga0207657_10001874 3300025919 Bacteria 22755
64 Ga0207657_10014428 3300025919 Bacteria 7716
65 Ga0207657_10032589 3300025919 Bacteria 4706
66 Ga0207652_10009256 3300025921 Bacteria 7923
67 Ga0207652_10355241 3300025921 Bacteria 1323
68 Ga0207687_10315472 3300025927 Bacteria 1264
69 Ga0207687_10959213 3300025927 Unclassified 733
70 Ga0207664_10019387 3300025929 Bacteria 5027
71 Ga0207644_10139583 3300025931 Bacteria 1865
72 Ga0207644_11499217 3300025931 Bacteria 566
73 Ga0207670_10073392 3300025936 Bacteria 2372
74 Ga0207661_10250475 3300025944 Bacteria 1574
75 Ga0207639_10541152 3300026041 Bacteria 1068
76 Ga0207675_100160208 3300026118 Bacteria 2146
77 Ga0207698_10469314 3300026142 Bacteria 1219
78 Ga0268266_10775590 3300028379 Bacteria 926
79 Ga0265327_10141500 3300031251 Unclassified 1124
80 Ga0395899_0599945 3300037312 Bacteria 701
81 Ga0395900_0065814 3300037418 Bacteria 3723
82 Ga0395900_0292413 3300037418 Bacteria 1617
83 Ga0395898_0106776 3300037466 Bacteria 2685
84 Ga0395898_0471002 3300037466 Bacteria 1195
85 Ga0395898_0520591 3300037466 Bacteria 1131
86 Ga0395898_0627566 3300037466 Bacteria 1017
87 Ga0395905_0107933 3300037471 Bacteria 2613
88 Ga0395905_0186983 3300037471 Bacteria 1944
89 Ga0395905_0367605 3300037471 Bacteria 1331
90 Ga0395905_0635346 3300037471 Bacteria 969
91 Ga0436364_0326974 3300037853 Bacteria 1540
92 Ga0395901_0222491 3300038443 Bacteria 1973
93 Ga0395901_0379930 3300038443 Bacteria 1454
94 Ga0395901_0559155 3300038443 Bacteria 1158
95 Ga0395901_0866220 3300038443 Bacteria 887
96 Ga0436365_1307606 3300039437 Bacteria 1421
97 Ga0436365_1366736 3300039437 Bacteria 5865
98 Ga0436365_1898113 3300039437 Unclassified 1296
99 Ga0436362_1252616 3300039453 Bacteria 608
100 Ga0451853_2724986 3300041512 Bacteria 950
101 Ga0466966_0032754 3300044684 Bacteria 3365
102 Ga0466966_0090718 3300044684 Bacteria 1897
103 Ga0466963_0014583 3300044694 Bacteria 4850
104 Ga0466963_0201839 3300044694 Bacteria 1391
105 Ga0466963_0774572 3300044694 Bacteria 677
106 Ga0466964_0057180 3300044706 Bacteria 1614
107 Ga0466964_0081804 3300044706 Bacteria 1387
108 Ga0466964_0177370 3300044706 Bacteria 1008
109 Ga0466964_0327299 3300044706 Bacteria 780
110 Ga0466971_0069151 3300044719 Bacteria 1602
111 Ga0466968_0008710 3300044735 Bacteria 3890
112 Ga0466957_0034163 3300044842 Bacteria 3051
113 Ga0466957_0103244 3300044842 Bacteria 1799
114 Ga0466957_1243983 3300044842 Bacteria 539
115 Ga0466960_0043656 3300044901 Bacteria 2134
116 Ga0466960_0225080 3300044901 Bacteria 1034
117 Ga0466959_0109566 3300045049 Bacteria 1971
118 Ga0466958_0132155 3300045836 Bacteria 1568
119 Ga0466958_0225050 3300045836 Bacteria 1197
120 Ga0466958_0318085 3300045836 Bacteria 1000
121 Ga0466967_0066669 3300045976 Bacteria 3208
122 Ga0466967_0080305 3300045976 Bacteria 2942
123 Ga0466967_0097638 3300045976 Bacteria 2681
124 Ga0466967_0215081 3300045976 Bacteria 1824
125 Ga0466967_0564627 3300045976 Bacteria 1121
126 Ga0466967_0743581 3300045976 Unclassified 972
127 Ga0466967_1162004 3300045976 Bacteria 769
128 Ga0466967_1683165 3300045976 Unclassified 632
129 Ga0495603_0023386 3300046455 Bacteria 3740
130 Ga0495651_0834658 3300046462 Bacteria 567
131 Ga0495653_0025714 3300046463 Bacteria 4724
132 Ga0495653_0099454 3300046463 Bacteria 2111
133 Ga0495605_0157663 3300046474 Bacteria 1009
134 Ga0495584_0189938 3300046491 Bacteria 1044
135 Ga0495608_0682565 3300046511 Bacteria 612
136 Ga0495630_0027295 3300046517 Bacteria 4234
137 Ga0495630_0626127 3300046517 Bacteria 824
138 Ga0495665_0080692 3300046531 Bacteria 1711
139 Ga0495640_0773438 3300046533 Bacteria 573
140 Ga0495645_0094689 3300046543 Bacteria 2130
141 Ga0495667_0091497 3300046559 Bacteria 1970
142 Ga0495667_0152056 3300046559 Bacteria 1490
143 Ga0495667_0781296 3300046559 Bacteria 589
144 Ga0495634_0712019 3300046642 Bacteria 577
145 Ga0495635_0220701 3300046663 Bacteria 1282
146 Ga0495635_0354771 3300046663 Unclassified 978
147 Ga0495657_0582805 3300046675 Unclassified 648
148 Ga0495647_0022393 3300046681 Bacteria 2282
149 Ga0495658_0347766 3300046683 Bacteria 942
150 Ga0495624_0357109 3300046690 Bacteria 879
151 Ga0495589_0114040 3300046794 Bacteria 1303
152 Ga0495604_0195148 3300047317 Bacteria 1408
153 Ga0495674_0495384 3300047319 Unclassified 978
154 Ga0495680_0282800 3300047322 Unclassified 1169
155 Ga0495680_0415384 3300047322 Bacteria 926
156 Ga0495677_0191983 3300047445 Unclassified 793
157 Ga0495593_0228265 3300047673 Bacteria 934
158 Ga0495593_0255656 3300047673 Unclassified 877
159 Ga0495602_0203671 3300048088 Bacteria 1508
160 Ga0496101_0579916 3300048904 Bacteria 887
161 Ga0496103_0038879 3300048906 Bacteria 2922
162 Ga0496105_0194202 3300048908 Bacteria 1659
163 Ga0496107_0244352 3300048910 Unclassified 1336
164 Ga0496108_0113827 3300048911 Bacteria 2316
165 Ga0496108_0222046 3300048911 Bacteria 1642
166 Ga0496108_0466281 3300048911 Bacteria 1104
167 Ga0496108_0714079 3300048911 Bacteria 869
168 Ga0496108_0774194 3300048911 Bacteria 829
169 Ga0496110_1356647 3300048913 Bacteria 620
170 Ga0496112_0005168 3300048915 Bacteria 11217
171 Ga0496112_0005636 3300048915 Bacteria 10867
172 Ga0496112_0087534 3300048915 Bacteria 3082
173 Ga0496112_0968235 3300048915 Unclassified 771
174 Ga0496112_0977226 3300048915 Bacteria 767
175 Ga0496113_1022947 3300048916 Bacteria 650
176 Ga0496114_0209003 3300048917 Bacteria 1711
177 Ga0501038_0161315 3300049574 Bacteria 1822
178 Ga0501046_0052561 3300049580 Bacteria 3211
179 Ga0501047_0035487 3300049581 Bacteria 4818
180 Ga0501067_0000957 3300049583 Bacteria 15468
181 Ga0501067_0028619 3300049583 Bacteria 3088
182 Ga0501067_0055462 3300049583 Bacteria 2196
183 Ga0501069_0398712 3300049585 Bacteria 814
184 Ga0501069_0444559 3300049585 Bacteria 770
185 Ga0501070_0512341 3300049586 Bacteria 963
186 Ga0501080_1284014 3300049742 Bacteria 627
187 Ga0501044_0564821 3300049823 Bacteria 1034
188 nmdc:mga0yw44_151074_c1 3300050492 Bacteria 1515
189 nmdc:mga0n895_155332_c1 3300050512 Bacteria 2318
190 Ga0495601_0683348 3300053077 Unclassified 655
191 Ga0495612_0092394 3300053078 Bacteria 1283
192 Ga0495619_0022572 3300053085 Bacteria 4029
193 Ga0495619_0037230 3300053085 Bacteria 3168
194 Ga0466962_0040590 3300061719 Bacteria 2227
195 Ga0206353_10087137
196 Ga0070658_10011730
197 Ga0070658_10036922
198 Ga0070658_10066379
199 Ga0070658_10482953
200 Ga0070658_10575050
201 Ga0070683_100141827
202 Ga0068869_100239937
203 Ga0070680_100061889
204 Ga0070660_100019375
205 Ga0070660_100110114
206 Ga0070660_100148891
207 Ga0070660_100683822
208 Ga0070659_100166684
209 Ga0070659_100310703
210 Ga0070714_100023572
211 Ga0070714_100800606
212 Ga0070714_100944355
213 Ga0070701_10435362
214 Ga0070711_100174181
215 Ga0070705_100511508
216 Ga0070708_101174845
217 Ga0070681_10062178
218 Ga0070681_10086252
219 Ga0070681_10759299
220 Ga0070685_10097877
221 Ga0070679_100080075
222 Ga0070679_100108539
223 Ga0070684_100058717
224 Ga0068853_100434499
225 Ga0068853_101418451
226 Ga0070696_101246895
227 Ga0070693_100495634
228 Ga0070693_100736908
229 Ga0070664_101536114
230 Ga0068852_101632578
231 Ga0081455_10119851
232 Ga0070717_10708496
233 Ga0075365_10129188
234 Ga0105240_10388366
235 Ga0105237_10923575
236 Ga0105237_11844100
237 Ga0105239_10009163
238 Ga0157371_10528893
239 Ga0157369_10063316
240 Ga0157369_10807383
241 Ga0157369_11407466
242 Ga0157374_10455774
243 Ga0157372_10729431
244 Ga0157375_10182186
245 Ga0206356_11666439
246 Ga0206350_11099700
247 Ga0213876_10028697
248 Ga0213875_10131660
249 Ga0207699_10813674
250 Ga0207705_10125635
251 Ga0207705_10558276
252 Ga0207707_10072614
253 Ga0207707_10150652
254 Ga0207695_10441965
255 Ga0207660_10096984
256 Ga0207660_10696881
257 Ga0207657_10001874
258 Ga0207657_10014428
259 Ga0207657_10032589
260 Ga0207652_10009256
261 Ga0207652_10355241
262 Ga0207687_10315472
263 Ga0207687_10959213
264 Ga0207664_10019387
265 Ga0207644_10139583
266 Ga0207644_11499217
267 Ga0207670_10073392
268 Ga0207661_10250475
269 Ga0207639_10541152
270 Ga0207675_100160208
271 Ga0207698_10469314
272 Ga0268266_10775590
273 Ga0265327_10141500
274 Ga0395899_0599945
275 Ga0395900_0065814
276 Ga0395900_0292413
277 Ga0395898_0106776
278 Ga0395898_0471002
279 Ga0395898_0520591
280 Ga0395898_0627566
281 Ga0395905_0107933
282 Ga0395905_0186983
283 Ga0395905_0367605
284 Ga0395905_0635346
285 Ga0436364_0326974
286 Ga0395901_0222491
287 Ga0395901_0379930
288 Ga0395901_0559155
289 Ga0395901_0866220
290 Ga0436365_1307606
291 Ga0436365_1366736
292 Ga0436365_1898113
293 Ga0436362_1252616
294 Ga0451853_2724986
295 Ga0466966_0032754
296 Ga0466966_0090718
297 Ga0466963_0014583
298 Ga0466963_0201839
299 Ga0466963_0774572
300 Ga0466964_0057180
301 Ga0466964_0081804
302 Ga0466964_0177370
303 Ga0466964_0327299
304 Ga0466971_0069151
305 Ga0466968_0008710
306 Ga0466957_0034163
307 Ga0466957_0103244
308 Ga0466957_1243983
309 Ga0466960_0043656
310 Ga0466960_0225080
311 Ga0466959_0109566
312 Ga0466958_0132155
313 Ga0466958_0225050
314 Ga0466958_0318085
315 Ga0466967_0066669
316 Ga0466967_0080305
317 Ga0466967_0097638
318 Ga0466967_0215081
319 Ga0466967_0564627
320 Ga0466967_0743581
321 Ga0466967_1162004
322 Ga0466967_1683165
323 Ga0495603_0023386
324 Ga0495651_0834658
325 Ga0495653_0025714
326 Ga0495653_0099454
327 Ga0495605_0157663
328 Ga0495584_0189938
329 Ga0495608_0682565
330 Ga0495630_0027295
331 Ga0495630_0626127
332 Ga0495665_0080692
333 Ga0495640_0773438
334 Ga0495645_0094689
335 Ga0495667_0091497
336 Ga0495667_0152056
337 Ga0495667_0781296
338 Ga0495634_0712019
339 Ga0495635_0220701
340 Ga0495635_0354771
341 Ga0495657_0582805
342 Ga0495647_0022393
343 Ga0495658_0347766
344 Ga0495624_0357109
345 Ga0495589_0114040
346 Ga0495604_0195148
347 Ga0495674_0495384
348 Ga0495680_0282800
349 Ga0495680_0415384
350 Ga0495677_0191983
351 Ga0495593_0228265
352 Ga0495593_0255656
353 Ga0495602_0203671
354 Ga0496101_0579916
355 Ga0496103_0038879
356 Ga0496105_0194202
357 Ga0496107_0244352
358 Ga0496108_0113827
359 Ga0496108_0222046
360 Ga0496108_0466281
361 Ga0496108_0714079
362 Ga0496108_0774194
363 Ga0496110_1356647
364 Ga0496112_0005168
365 Ga0496112_0005636
366 Ga0496112_0087534
367 Ga0496112_0968235
368 Ga0496112_0977226
369 Ga0496113_1022947
370 Ga0496114_0209003
371 Ga0501038_0161315
372 Ga0501046_0052561
373 Ga0501047_0035487
374 Ga0501067_0000957
375 Ga0501067_0028619
376 Ga0501067_0055462
377 Ga0501069_0398712
378 Ga0501069_0444559
379 Ga0501070_0512341
380 Ga0501080_1284014
381 Ga0501044_0564821
382 nmdc:mga0yw44_151074_c1
383 nmdc:mga0n895_155332_c1
384 Ga0495601_0683348
385 Ga0495612_0092394
386 Ga0495619_0022572
387 Ga0495619_0037230
388 Ga0466962_0040590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07098

DUF1360

Protein of unknown function (DUF1360)

60

156

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tve-assembly1.cif.gz_D atp and dna bound smc5/6 core complex 0.2515 3 137
7tve-assembly1.cif.gz_D atp and dna bound smc5/6 core complex 0.2337 3 137
7pua-assembly1.cif.gz_Fh middle assembly intermediate of the trypanosoma brucei mitoribosomal small subunit 0.2207 8 144
7pua-assembly1.cif.gz_Fh middle assembly intermediate of the trypanosoma brucei mitoribosomal small subunit 0.2082 8 144
6pfv-assembly3.cif.gz_E structure of s. venezuelae risg-whig-c-di-gmp complex: orthorhombic crystal form 0.2027 31 127
ID Description Score Start End Superfamily
af_O00476_28_185_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3346 30 126 1.20.1250.20
af_P76226_9_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.3288 8 132 1.20.120.1760
af_I1J7S6_1_152_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3246 3 145 1.20.58.70
af_A0A1D6JIG9_474_660_3.30.420.110 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;MutS, connector domain 0.3236 29 116 3.30.420.110
af_A0A1D6JA16_1175_1348_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.3215 7 125 1.10.1520.10
ID Description Score Start End GO Terms
AF-A0A7Y5XXI0-F1-model_v4 DUF1360 domain-containing protein 0.7937 2 141 GO:0016020
AF-A0A1F6EZ43-F1-model_v4 DUF1360 domain-containing protein 0.7901 3 143 GO:0016020
AF-A0A7W1LHI5-F1-model_v4 DUF1360 domain-containing protein 0.7889 2 144
AF-A0A6J4TIT3-F1-model_v4 DUF1360 domain-containing protein 0.7864 3 142
AF-A0A7W0SKP0-F1-model_v4 DUF1360 domain-containing protein 0.7789 4 139 GO:0016020

Map