F298253

General Info

Members Datasets Scaffolds Average Seq Length
194 154 388 198

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_101001039|Ga0070714_1010010391
Length 236
Sequence MKALLAASRISLVLFVLCGLLYPLALTAIGQLVLPFQANGSLERTDAGTVIGSRLIGQQWDGPEWFHARPSATTDTDASDPSKSVSAPYNAANSGGSNLGPTSKALLDRLLQDRKALQAAEPELLGQHLPSDMLTTSASGLDPDISPANAALQVPRIARARGLAADQILSLVETHVTGRTFGIFGEPRVNVLALNLALDQACGATNARCKTSSMLRSSQLGSLAQHVAPPMTRHGP

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
40 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
46 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
62 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
63 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
64 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
65 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
75 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
76 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
77 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
78 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
103 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
104 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
143 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
150 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
151 2904504865 Serratia marcescens 1822 Isolate Unclassified
152 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
153 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
154 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.85
Metatranscriptomes 2.06
Isolates 3.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.25
Nodule 1.55
Rhizoplane 1.03
Rhizosphere 82.99
Stem 0
Stem Tuber 0
Unclassified 4.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_101001039 3300005435 Unclassified 813
2 Ga0055526_1000213 3300003771 Bacteria 50112
3 Ga0055524_1007108 3300003775 Bacteria 4796
4 Ga0070690_100198325 3300005330 Bacteria 1395
5 Ga0070661_100016072 3300005344 Bacteria 5282
6 Ga0070710_10729052 3300005437 Bacteria 702
7 Ga0070711_100475872 3300005439 Unclassified 1026
8 Ga0070708_100301748 3300005445 Bacteria 1508
9 Ga0070681_10057052 3300005458 Bacteria 3886
10 Ga0070685_10947513 3300005466 Bacteria 643
11 Ga0070706_100002938 3300005467 Bacteria 16943
12 Ga0070706_100556144 3300005467 Bacteria 1067
13 Ga0070679_100110145 3300005530 Bacteria 2740
14 Ga0068853_100013380 3300005539 Bacteria 6697
15 Ga0068853_100132215 3300005539 Bacteria 2235
16 Ga0068855_100006251 3300005563 Bacteria 14522
17 Ga0068855_100131938 3300005563 Bacteria 2852
18 Ga0068854_100454908 3300005578 Bacteria 1070
19 Ga0068854_100535279 3300005578 Unclassified 991
20 Ga0068856_100006050 3300005614 Bacteria 11891
21 Ga0068864_100936200 3300005618 Bacteria 857
22 Ga0081539_10016649 3300005985 Bacteria 5229
23 Ga0070717_10872137 3300006028 Unclassified 819
24 Ga0075365_10181586 3300006038 Bacteria 1471
25 Ga0075363_100424810 3300006048 Bacteria 783
26 Ga0075367_10000252 3300006178 Bacteria 18196
27 Ga0075367_10020872 3300006178 Bacteria 3654
28 Ga0075369_10025694 3300006186 Bacteria 2451
29 Ga0075370_10076223 3300006353 Bacteria 1923
30 Ga0068871_100060618 3300006358 Bacteria 3087
31 Ga0075436_100292030 3300006914 Bacteria 1167
32 Ga0075436_100771464 3300006914 Bacteria 715
33 Ga0105250_10000073 3300009092 Bacteria 94051
34 Ga0111539_10129582 3300009094 Bacteria 2954
35 Ga0114129_10371639 3300009147 Bacteria 1890
36 Ga0105241_10210165 3300009174 Bacteria 1630
37 Ga0105239_10018053 3300010375 Bacteria 7803
38 Ga0105239_10286991 3300010375 Bacteria 1853
39 Ga0157373_10258119 3300013100 Bacteria 1233
40 Ga0157369_10002856 3300013105 Bacteria 20635
41 Ga0157369_10085997 3300013105 Bacteria 3359
42 Ga0163162_11961464 3300013306 Bacteria 671
43 Ga0157372_10049916 3300013307 Bacteria 4654
44 Ga0157375_10216383 3300013308 Bacteria 2074
45 Ga0163163_10306724 3300014325 Bacteria 1640
46 Ga0157376_10915423 3300014969 Bacteria 896
47 Ga0182005_1015581 3300015265 Bacteria 2118
48 Ga0206350_10091728 3300020080 Bacteria 670
49 Ga0206350_10820716 3300020080 Bacteria 924
50 Ga0206353_10415118 3300020082 Bacteria 1270
51 Ga0213872_10089124 3300021361 Bacteria 1381
52 Ga0213876_10006440 3300021384 Bacteria 6399
53 Ga0209147_100485 3300025229 Bacteria 23821
54 Ga0209759_1005429 3300025256 Bacteria 4469
55 Ga0209673_1064581 3300025273 Bacteria 897
56 Ga0207696_1000148 3300025711 Bacteria 120559
57 Ga0207643_10434486 3300025908 Bacteria 833
58 Ga0207684_10000294 3300025910 Bacteria 71779
59 Ga0207663_10208950 3300025916 Bacteria 1413
60 Ga0207660_10462613 3300025917 Bacteria 1027
61 Ga0207687_10158487 3300025927 Bacteria 1734
62 Ga0207664_10570032 3300025929 Bacteria 1016
63 Ga0207664_10926599 3300025929 Unclassified 782
64 Ga0207711_10679091 3300025941 Bacteria 961
65 Ga0207667_10044280 3300025949 Bacteria 4717
66 Ga0207640_10761556 3300025981 Unclassified 836
67 Ga0207639_10014798 3300026041 Bacteria 5494
68 Ga0207702_10054812 3300026078 Bacteria 3379
69 Ga0268266_10149490 3300028379 Bacteria 2104
70 Ga0265766_1003673 3300030863 Bacteria 906
71 Ga0265330_10049559 3300031235 Bacteria 1844
72 Ga0265325_10005950 3300031241 Bacteria 7474
73 Ga0265325_10058382 3300031241 Bacteria 1965
74 Ga0265340_10009723 3300031247 Bacteria 5156
75 Ga0265340_10010246 3300031247 Bacteria 5016
76 Ga0265340_10054379 3300031247 Bacteria 1931
77 Ga0265340_10121179 3300031247 Bacteria 1203
78 Ga0265339_10029266 3300031249 Bacteria 3125
79 Ga0265339_10153155 3300031249 Bacteria 1164
80 Ga0265331_10069547 3300031250 Bacteria 1649
81 Ga0265316_10027738 3300031344 Bacteria 4682
82 Ga0265316_10067829 3300031344 Bacteria 2758
83 Ga0265313_10011997 3300031595 Bacteria 5340
84 Ga0265314_10001779 3300031711 Bacteria 23257
85 Ga0265314_10152707 3300031711 Bacteria 1414
86 Ga0265342_10007709 3300031712 Bacteria 7839
87 Ga0265342_10011925 3300031712 Bacteria 5913
88 Ga0307406_10176796 3300031901 Bacteria 1550
89 Ga0373923_0073527 3300035111 Bacteria 1472
90 Ga0373953_0002918 3300035117 Bacteria 5222
91 Ga0373954_0019445 3300035118 Bacteria 3064
92 Ga0373956_0016844 3300035119 Bacteria 3072
93 Ga0373957_0004432 3300035120 Bacteria 4273
94 Ga0373955_0065483 3300035172 Bacteria 2017
95 Ga0373961_0063729 3300035241 Bacteria 1125
96 Ga0373933_0053016 3300035724 Bacteria 2428
97 Ga0373933_0104472 3300035724 Bacteria 1761
98 Ga0373937_0019996 3300036401 Bacteria 5997
99 Ga0436364_0394424 3300037853 Bacteria 2650
100 Ga0436365_0458878 3300039437 Bacteria 1718
101 Ga0436365_1450463 3300039437 Bacteria 1053
102 Ga0436360_0594134 3300039438 Bacteria 1103
103 Ga0436360_0651141 3300039438 Bacteria 2544
104 Ga0436361_0093353 3300039447 Bacteria 1813
105 Ga0436361_0123067 3300039447 Unclassified 759
106 Ga0436361_0430935 3300039447 Bacteria 1141
107 Ga0436361_0456124 3300039447 Bacteria 3858
108 Ga0436363_0219757 3300039450 Bacteria 971
109 Ga0436362_0603826 3300039453 Bacteria 1860
110 Ga0466972_0007026 3300044658 Bacteria 5649
111 Ga0466963_0432819 3300044694 Bacteria 928
112 Ga0453684_0001102 3300044712 Bacteria 84864
113 Ga0453684_0032065 3300044712 Bacteria 7366
114 Ga0453684_0057740 3300044712 Bacteria 5019
115 Ga0453684_0128657 3300044712 Bacteria 3042
116 Ga0453684_0660247 3300044712 Bacteria 1140
117 Ga0453684_0754071 3300044712 Bacteria 1053
118 Ga0466968_0024897 3300044735 Bacteria 2449
119 Ga0466970_0182962 3300044765 Bacteria 1163
120 Ga0466957_0503936 3300044842 Bacteria 839
121 Ga0466960_0001182 3300044901 Bacteria 9409
122 Ga0466958_0005250 3300045836 Bacteria 6943
123 Ga0495592_0113325 3300046454 Bacteria 1916
124 Ga0495603_0018394 3300046455 Bacteria 4228
125 Ga0495603_0019924 3300046455 Bacteria 4063
126 Ga0495629_0407768 3300046459 Bacteria 923
127 Ga0495651_0103372 3300046462 Bacteria 2117
128 Ga0495650_0000007 3300046471 Bacteria 718072
129 Ga0495664_0562743 3300046477 Bacteria 679
130 Ga0495585_0056271 3300046492 Bacteria 2173
131 Ga0495594_0118199 3300046499 Bacteria 1498
132 Ga0495596_0008381 3300046500 Bacteria 4604
133 Ga0495596_0061194 3300046500 Bacteria 1467
134 Ga0495607_0092480 3300046501 Bacteria 1636
135 Ga0495583_0099679 3300046506 Bacteria 1241
136 Ga0495606_0075547 3300046507 Bacteria 2108
137 Ga0495608_0028756 3300046511 Bacteria 3777
138 Ga0495610_0218203 3300046512 Bacteria 772
139 Ga0495618_0257220 3300046514 Bacteria 1094
140 Ga0495637_0023544 3300046520 Bacteria 2797
141 Ga0495643_0042320 3300046522 Bacteria 2481
142 Ga0495587_0009049 3300046536 Bacteria 6391
143 Ga0495587_0185298 3300046536 Bacteria 1179
144 Ga0495667_0235892 3300046559 Bacteria 1166
145 Ga0495667_0300707 3300046559 Bacteria 1016
146 Ga0495588_0016829 3300046674 Bacteria 3539
147 Ga0495657_0210327 3300046675 Bacteria 1182
148 Ga0495599_0025933 3300046678 Bacteria 3672
149 Ga0495658_0183439 3300046683 Bacteria 1299
150 Ga0495670_0105086 3300046691 Bacteria 1458
151 Ga0495600_0177423 3300046809 Bacteria 1373
152 Ga0495680_0098621 3300047322 Bacteria 2180
153 Ga0495680_0112652 3300047322 Bacteria 2015
154 Ga0495680_0284093 3300047322 Bacteria 1165
155 Ga0495675_0057575 3300047444 Bacteria 2464
156 Ga0495681_0275548 3300047470 Bacteria 657
157 Ga0496104_0844750 3300048907 Unclassified 821
158 Ga0496115_0616193 3300048918 Unclassified 861
159 Ga0496122_0060853 3300048925 Bacteria 2777
160 Ga0496123_0101981 3300048926 Bacteria 1667
161 Ga0496125_0067914 3300048928 Bacteria 2806
162 Ga0496125_0349563 3300048928 Bacteria 884
163 Ga0501034_0355791 3300049571 Bacteria 1392
164 Ga0501034_0862303 3300049571 Bacteria 795
165 Ga0501036_0163184 3300049572 Bacteria 1878
166 Ga0501038_0081241 3300049574 Bacteria 2731
167 Ga0501047_0156020 3300049581 Bacteria 2156
168 Ga0501068_0151064 3300049584 Bacteria 1460
169 Ga0501069_0322120 3300049585 Bacteria 908
170 Ga0501073_0269936 3300049589 Bacteria 1174
171 Ga0501073_0285263 3300049589 Bacteria 1139
172 Ga0501074_0102787 3300049590 Bacteria 2046
173 Ga0501079_0512991 3300049741 Bacteria 943
174 Ga0501044_0050905 3300049823 Bacteria 4272
175 nmdc:mga03n38_108888_c1 3300050490 Bacteria 1346
176 nmdc:mga0yw44_34638_c1 3300050492 Bacteria 2960
177 nmdc:mga06z11_7608_c1 3300050494 Bacteria 4470
178 nmdc:mga07m45_19215_c2 3300050496 Bacteria 2129
179 nmdc:mga05p37_793132_c1 3300050507 Bacteria 1037
180 nmdc:mga05p37_819605_c1 3300050507 Bacteria 1015
181 nmdc:mga0sz30_38129_c1 3300050516 Bacteria 2013
182 Ga0495612_0104165 3300053078 Bacteria 1210
183 Ga0495595_0008759 3300053084 Bacteria 4166
184 Ga0495595_0029025 3300053084 Bacteria 2472
185 Ga0495619_0078311 3300053085 Bacteria 2222
186 Ga0500618_001752 3300053125 Bacteria 9205
187 Ga0501084_0000033 3300054114 Bacteria 114778
188 Ga0501082_0128363 3300060353 Bacteria 2200
189 2513655200 2513237096 Bacteria 8722461
190 2897805129 2897803580 Bacteria 7000062
191 2904508910 2904504865 Bacteria 5152820
192 2904698049 2904690495 Bacteria 9412302
193 2908763086 2908756301 Bacteria 8864324
194 2939672491 2939669807 Bacteria 5028511
195 Ga0070714_101001039
196 Ga0055526_1000213
197 Ga0055524_1007108
198 Ga0070690_100198325
199 Ga0070661_100016072
200 Ga0070710_10729052
201 Ga0070711_100475872
202 Ga0070708_100301748
203 Ga0070681_10057052
204 Ga0070685_10947513
205 Ga0070706_100002938
206 Ga0070706_100556144
207 Ga0070679_100110145
208 Ga0068853_100013380
209 Ga0068853_100132215
210 Ga0068855_100006251
211 Ga0068855_100131938
212 Ga0068854_100454908
213 Ga0068854_100535279
214 Ga0068856_100006050
215 Ga0068864_100936200
216 Ga0081539_10016649
217 Ga0070717_10872137
218 Ga0075365_10181586
219 Ga0075363_100424810
220 Ga0075367_10000252
221 Ga0075367_10020872
222 Ga0075369_10025694
223 Ga0075370_10076223
224 Ga0068871_100060618
225 Ga0075436_100292030
226 Ga0075436_100771464
227 Ga0105250_10000073
228 Ga0111539_10129582
229 Ga0114129_10371639
230 Ga0105241_10210165
231 Ga0105239_10018053
232 Ga0105239_10286991
233 Ga0157373_10258119
234 Ga0157369_10002856
235 Ga0157369_10085997
236 Ga0163162_11961464
237 Ga0157372_10049916
238 Ga0157375_10216383
239 Ga0163163_10306724
240 Ga0157376_10915423
241 Ga0182005_1015581
242 Ga0206350_10091728
243 Ga0206350_10820716
244 Ga0206353_10415118
245 Ga0213872_10089124
246 Ga0213876_10006440
247 Ga0209147_100485
248 Ga0209759_1005429
249 Ga0209673_1064581
250 Ga0207696_1000148
251 Ga0207643_10434486
252 Ga0207684_10000294
253 Ga0207663_10208950
254 Ga0207660_10462613
255 Ga0207687_10158487
256 Ga0207664_10570032
257 Ga0207664_10926599
258 Ga0207711_10679091
259 Ga0207667_10044280
260 Ga0207640_10761556
261 Ga0207639_10014798
262 Ga0207702_10054812
263 Ga0268266_10149490
264 Ga0265766_1003673
265 Ga0265330_10049559
266 Ga0265325_10005950
267 Ga0265325_10058382
268 Ga0265340_10009723
269 Ga0265340_10010246
270 Ga0265340_10054379
271 Ga0265340_10121179
272 Ga0265339_10029266
273 Ga0265339_10153155
274 Ga0265331_10069547
275 Ga0265316_10027738
276 Ga0265316_10067829
277 Ga0265313_10011997
278 Ga0265314_10001779
279 Ga0265314_10152707
280 Ga0265342_10007709
281 Ga0265342_10011925
282 Ga0307406_10176796
283 Ga0373923_0073527
284 Ga0373953_0002918
285 Ga0373954_0019445
286 Ga0373956_0016844
287 Ga0373957_0004432
288 Ga0373955_0065483
289 Ga0373961_0063729
290 Ga0373933_0053016
291 Ga0373933_0104472
292 Ga0373937_0019996
293 Ga0436364_0394424
294 Ga0436365_0458878
295 Ga0436365_1450463
296 Ga0436360_0594134
297 Ga0436360_0651141
298 Ga0436361_0093353
299 Ga0436361_0123067
300 Ga0436361_0430935
301 Ga0436361_0456124
302 Ga0436363_0219757
303 Ga0436362_0603826
304 Ga0466972_0007026
305 Ga0466963_0432819
306 Ga0453684_0001102
307 Ga0453684_0032065
308 Ga0453684_0057740
309 Ga0453684_0128657
310 Ga0453684_0660247
311 Ga0453684_0754071
312 Ga0466968_0024897
313 Ga0466970_0182962
314 Ga0466957_0503936
315 Ga0466960_0001182
316 Ga0466958_0005250
317 Ga0495592_0113325
318 Ga0495603_0018394
319 Ga0495603_0019924
320 Ga0495629_0407768
321 Ga0495651_0103372
322 Ga0495650_0000007
323 Ga0495664_0562743
324 Ga0495585_0056271
325 Ga0495594_0118199
326 Ga0495596_0008381
327 Ga0495596_0061194
328 Ga0495607_0092480
329 Ga0495583_0099679
330 Ga0495606_0075547
331 Ga0495608_0028756
332 Ga0495610_0218203
333 Ga0495618_0257220
334 Ga0495637_0023544
335 Ga0495643_0042320
336 Ga0495587_0009049
337 Ga0495587_0185298
338 Ga0495667_0235892
339 Ga0495667_0300707
340 Ga0495588_0016829
341 Ga0495657_0210327
342 Ga0495599_0025933
343 Ga0495658_0183439
344 Ga0495670_0105086
345 Ga0495600_0177423
346 Ga0495680_0098621
347 Ga0495680_0112652
348 Ga0495680_0284093
349 Ga0495675_0057575
350 Ga0495681_0275548
351 Ga0496104_0844750
352 Ga0496115_0616193
353 Ga0496122_0060853
354 Ga0496123_0101981
355 Ga0496125_0067914
356 Ga0496125_0349563
357 Ga0501034_0355791
358 Ga0501034_0862303
359 Ga0501036_0163184
360 Ga0501038_0081241
361 Ga0501047_0156020
362 Ga0501068_0151064
363 Ga0501069_0322120
364 Ga0501073_0269936
365 Ga0501073_0285263
366 Ga0501074_0102787
367 Ga0501079_0512991
368 Ga0501044_0050905
369 nmdc:mga03n38_108888_c1
370 nmdc:mga0yw44_34638_c1
371 nmdc:mga06z11_7608_c1
372 nmdc:mga07m45_19215_c2
373 nmdc:mga05p37_793132_c1
374 nmdc:mga05p37_819605_c1
375 nmdc:mga0sz30_38129_c1
376 Ga0495612_0104165
377 Ga0495595_0008759
378 Ga0495595_0029025
379 Ga0495619_0078311
380 Ga0500618_001752
381 Ga0501084_0000033
382 Ga0501082_0128363
383 2513655200
384 2897805129
385 2904508910
386 2904698049
387 2908763086
388 2939672491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

4

200

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.8913 5 199
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.8893 6 198
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.8714 6 198
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.8692 5 199
1kcy-assembly1.cif.gz_A nmr solution structure of apo calbindin d9k (f36g + p43m mutant) 0.525 109 199
ID Description Score Start End Superfamily
af_B0G147_169_273_1.10.238.200 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;Cullin, PONY binding domain 0.6296 139 196 1.10.238.200
1hf0B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.5557 110 171 1.10.10.60
af_Q57688_1_236_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.5537 144 188 3.40.1190.20
1kcyA00 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.525 109 199 1.10.238.10
af_Q22167_15_155_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.502 101 193 1.10.238.10
ID Description Score Start End GO Terms
AF-A0A536ZNA7-F1-model_v4 Potassium-transporting ATPase subunit C 0.9671 123 196 GO:0005524
GO:0005886
GO:0008556
AF-D5RTV0-F1-model_v4 Potassium-transporting ATPase subunit C 0.9671 153 198 GO:0005524
GO:0005886
GO:0008556
AF-I3E0A1-F1-model_v4 Potassium-transporting ATPase C chain 0.9661 126 198 GO:0005524
GO:0005886
GO:0008556
AF-A0A3L9ZEW8-F1-model_v4 K+-transporting ATPase C subunit 0.9623 132 198 GO:0005524
GO:0005886
GO:0008556
AF-A0A8B3G858-F1-model_v4 deleted 0.9608 142 196

Map