F297838

General Info

Members Datasets Scaffolds Average Seq Length
193 147 386 192

Family's Representative Sequence

Representative Sequence 3300053088|Ga0500644_0262600|Ga0500644_0262600_14_649
Length 211
Sequence MMFNRRNDLPDAVSYIMRSTMRLPLLPPATLNAEQRPLYDDMRKGIETNFKGFTAIDADGQLIGPWNPWLRFPQFGGPVWDLVKAMSSSPTLPKPVREIAILVTGARFHSAYELYAHVLVAELRGIPDDKIATIIAGQRPGDLTREEAVAYDMASALVAGGVLPPLTYSQAIGLFGETGTAEFIYLVGLYCMVSVTLNGFNVPVPEDGRLT

Samples

Sample ID Description Type Environment
1 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
56 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
61 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
62 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
63 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
64 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
71 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
72 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
78 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
79 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
87 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
113 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
136 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
137 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
138 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
139 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
142 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
146 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
147 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.18
Nodule 0
Rhizoplane 14.51
Rhizosphere 74.09
Stem 0
Stem Tuber 0
Unclassified 12.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500644_0262600 3300053088 Bacteria 731
2 rootH2_10094019 3300003320 Bacteria 2393
3 rootL2_10025826 3300003322 Bacteria 1086
4 rootH1_10083037 3300003323 Bacteria 6836
5 Ga0065704_10078900 3300005289 Bacteria 4308
6 Ga0065715_10040243 3300005293 Bacteria 1435
7 Ga0070691_10113037 3300005341 Bacteria 1360
8 Ga0070714_101006913 3300005435 Bacteria 811
9 Ga0070713_100712230 3300005436 Bacteria 959
10 Ga0070711_100368994 3300005439 Bacteria 1158
11 Ga0070662_100305305 3300005457 Bacteria 1294
12 Ga0070681_10265236 3300005458 Bacteria 1629
13 Ga0070681_10285401 3300005458 Bacteria 1561
14 Ga0068853_100060671 3300005539 Bacteria 3269
15 Ga0070695_100838671 3300005545 Unclassified 739
16 Ga0070665_100103429 3300005548 Bacteria 2851
17 Ga0070704_100043881 3300005549 Bacteria 3103
18 Ga0068858_100286499 3300005842 Bacteria 1569
19 Ga0068858_100587933 3300005842 Bacteria 1079
20 Ga0068862_101522416 3300005844 Bacteria 675
21 Ga0081538_10251030 3300005981 Unclassified 674
22 Ga0081540_1109609 3300005983 Bacteria 1170
23 Ga0070712_100000256 3300006175 Bacteria 29738
24 Ga0070712_100061336 3300006175 Unclassified 2656
25 Ga0070712_100986162 3300006175 Bacteria 729
26 Ga0075428_100407149 3300006844 Bacteria 1457
27 Ga0075430_100400702 3300006846 Bacteria 1133
28 Ga0075431_100026840 3300006847 Bacteria 5906
29 Ga0075433_10500465 3300006852 Unclassified 1070
30 Ga0075434_100163216 3300006871 Bacteria 2248
31 Ga0075434_100229513 3300006871 Bacteria 1876
32 Ga0075434_100435382 3300006871 Unclassified 1332
33 Ga0075436_100449068 3300006914 Unclassified 938
34 Ga0075435_100438049 3300007076 Unclassified 1126
35 Ga0075435_100756015 3300007076 Unclassified 846
36 Ga0099794_10417775 3300007265 Unclassified 701
37 Ga0111539_10436622 3300009094 Bacteria 1525
38 Ga0111539_10680674 3300009094 Bacteria 1197
39 Ga0105247_10435961 3300009101 Bacteria 941
40 Ga0114129_10096278 3300009147 Bacteria 4098
41 Ga0114129_10911957 3300009147 Bacteria 1113
42 Ga0114129_10939709 3300009147 Bacteria 1093
43 Ga0114129_11387942 3300009147 Unclassified 867
44 Ga0105237_11310456 3300009545 Unclassified 730
45 Ga0105238_10053207 3300009551 Bacteria 4068
46 Ga0105239_10142727 3300010375 Bacteria 2670
47 Ga0105246_10568767 3300011119 Bacteria 974
48 Ga0157374_10429443 3300013296 Bacteria 1321
49 Ga0157378_10431892 3300013297 Bacteria 1304
50 Ga0157375_10742777 3300013308 Bacteria 1133
51 Ga0163163_10142897 3300014325 Bacteria 2436
52 Ga0157379_10823504 3300014968 Bacteria 877
53 Ga0213876_10112384 3300021384 Bacteria 1446
54 Ga0213871_10033848 3300021441 Bacteria 1345
55 Ga0213871_10035806 3300021441 Bacteria 1314
56 Ga0207693_10000612 3300025915 Bacteria 31937
57 Ga0207693_10036272 3300025915 Bacteria 3886
58 Ga0207693_10102592 3300025915 Bacteria 2243
59 Ga0207693_10641035 3300025915 Unclassified 826
60 Ga0207663_10357144 3300025916 Bacteria 1108
61 Ga0207663_10431233 3300025916 Bacteria 1013
62 Ga0207657_10557724 3300025919 Bacteria 895
63 Ga0207700_10197505 3300025928 Bacteria 1693
64 Ga0207706_10222277 3300025933 Bacteria 1653
65 Ga0207706_10831434 3300025933 Unclassified 783
66 Ga0207665_10052313 3300025939 Bacteria 2751
67 Ga0207668_10431061 3300025972 Bacteria 1121
68 Ga0207703_10247219 3300026035 Bacteria 1606
69 Ga0207675_100180539 3300026118 Bacteria 2021
70 Ga0268266_10075738 3300028379 Bacteria 2923
71 Ga0268265_10391185 3300028380 Bacteria 1282
72 Ga0265332_10003643 3300031238 Bacteria 7385
73 Ga0265340_10022623 3300031247 Bacteria 3213
74 Ga0265331_10015715 3300031250 Bacteria 3990
75 Ga0265316_10289958 3300031344 Bacteria 1194
76 Ga0265314_10066573 3300031711 Bacteria 2429
77 Ga0265342_10000073 3300031712 Bacteria 106620
78 Ga0373936_0167757 3300035113 Bacteria 959
79 Ga0373954_0422328 3300035118 Unclassified 660
80 Ga0373943_0044079 3300035170 Bacteria 2170
81 Ga0373943_0220892 3300035170 Bacteria 1055
82 Ga0373935_0353502 3300035692 Bacteria 1048
83 Ga0373927_0025179 3300035695 Bacteria 3890
84 Ga0373927_0083853 3300035695 Bacteria 2067
85 Ga0373947_0197402 3300035725 Bacteria 1315
86 Ga0373937_0367031 3300036401 Bacteria 1365
87 Ga0395905_0034840 3300037471 Bacteria 4726
88 Ga0436365_0706147 3300039437 Bacteria 1457
89 Ga0436360_0048513 3300039438 Bacteria 2041
90 Ga0436360_0210049 3300039438 Bacteria 1349
91 Ga0436360_0406283 3300039438 Unclassified 781
92 Ga0436360_0720575 3300039438 Bacteria 2175
93 Ga0436360_0735778 3300039438 Bacteria 3802
94 Ga0436360_0906656 3300039438 Bacteria 4654
95 Ga0436361_0664035 3300039447 Bacteria 1501
96 Ga0436361_0899243 3300039447 Bacteria 3206
97 Ga0436363_0604503 3300039450 Bacteria 3251
98 Ga0436362_0786995 3300039453 Unclassified 1684
99 Ga0436362_0805074 3300039453 Bacteria 858
100 Ga0495603_0016204 3300046455 Bacteria 4509
101 Ga0495629_0000108 3300046459 Bacteria 73826
102 Ga0495629_0339351 3300046459 Bacteria 1026
103 Ga0495580_0013675 3300046472 Bacteria 6185
104 Ga0495582_0009619 3300046473 Bacteria 5323
105 Ga0495639_0009382 3300046475 Bacteria 4196
106 Ga0495594_0003239 3300046499 Bacteria 8433
107 Ga0495666_0063694 3300046526 Bacteria 1760
108 Ga0495665_0066390 3300046531 Bacteria 1904
109 Ga0495640_0237257 3300046533 Bacteria 1145
110 Ga0495622_0012181 3300046557 Bacteria 3978
111 Ga0495634_0027514 3300046642 Bacteria 3956
112 Ga0495635_0250792 3300046663 Bacteria 1193
113 Ga0495588_0007875 3300046674 Bacteria 4867
114 Ga0495647_0247338 3300046681 Unclassified 793
115 Ga0495613_0009164 3300046689 Bacteria 7337
116 Ga0495624_0105638 3300046690 Bacteria 1733
117 Ga0495581_0022193 3300047315 Bacteria 3678
118 Ga0495581_0251321 3300047315 Bacteria 1034
119 Ga0495672_0168636 3300047320 Bacteria 1119
120 Ga0495676_0043869 3300047321 Bacteria 3655
121 Ga0495680_0366077 3300047322 Bacteria 1001
122 Ga0495684_0590554 3300047471 Unclassified 751
123 Ga0495686_0010594 3300047472 Bacteria 6549
124 Ga0495593_0019537 3300047673 Bacteria 3798
125 Ga0496100_0193527 3300048903 Bacteria 1478
126 Ga0496100_0818316 3300048903 Unclassified 730
127 Ga0496102_1251753 3300048905 Unclassified 661
128 Ga0496103_0235236 3300048906 Bacteria 1179
129 Ga0496104_0014662 3300048907 Bacteria 7080
130 Ga0496104_0267555 3300048907 Unclassified 1622
131 Ga0496105_0003780 3300048908 Bacteria 11283
132 Ga0496106_0252702 3300048909 Bacteria 1410
133 Ga0496107_0123878 3300048910 Bacteria 1905
134 Ga0496107_0278855 3300048910 Bacteria 1244
135 Ga0496108_0002264 3300048911 Bacteria 15418
136 Ga0496108_0862190 3300048911 Bacteria 779
137 Ga0496109_0004626 3300048912 Bacteria 11489
138 Ga0496109_0497206 3300048912 Bacteria 1151
139 Ga0496109_0594234 3300048912 Bacteria 1043
140 Ga0496110_0012053 3300048913 Bacteria 7102
141 Ga0496110_0038367 3300048913 Bacteria 4168
142 Ga0496110_0340727 3300048913 Bacteria 1366
143 Ga0496111_0040382 3300048914 Bacteria 3347
144 Ga0496111_0565733 3300048914 Unclassified 834
145 Ga0496112_0013269 3300048915 Bacteria 7607
146 Ga0496112_0619994 3300048915 Bacteria 1013
147 Ga0496113_0073514 3300048916 Bacteria 2605
148 Ga0496113_0287078 3300048916 Bacteria 1316
149 Ga0496113_0793228 3300048916 Bacteria 753
150 Ga0496114_0713295 3300048917 Bacteria 879
151 Ga0496115_0021231 3300048918 Bacteria 5014
152 Ga0496115_0967049 3300048918 Unclassified 653
153 Ga0496116_0358838 3300048919 Bacteria 664
154 Ga0496121_0000087 3300048924 Bacteria 222451
155 Ga0496124_0221062 3300048927 Bacteria 1424
156 Ga0496126_0055524 3300048929 Bacteria 3583
157 Ga0496126_0605454 3300048929 Bacteria 863
158 Ga0501033_0005489 3300049570 Bacteria 10037
159 Ga0501034_0178824 3300049571 Bacteria 2087
160 Ga0501038_0321002 3300049574 Bacteria 1211
161 Ga0501043_0328301 3300049579 Bacteria 1165
162 Ga0501047_0213291 3300049581 Bacteria 1788
163 Ga0501048_0000326 3300049582 Bacteria 32769
164 Ga0501069_0116355 3300049585 Bacteria 1525
165 Ga0501070_0703282 3300049586 Bacteria 799
166 Ga0501074_0228145 3300049590 Bacteria 1326
167 Ga0501080_0133038 3300049742 Bacteria 2302
168 Ga0501083_0038444 3300049744 Bacteria 3253
169 nmdc:mga06z11_44946_c1 3300050494 Bacteria 2230
170 nmdc:mga0qj67_271950_c1 3300050509 Bacteria 1374
171 nmdc:mga06r32_73969_c1 3300050510 Bacteria 3302
172 nmdc:mga08y16_1017553_c1 3300050511 Bacteria 808
173 nmdc:mga08y16_981487_c1 3300050511 Unclassified 826
174 nmdc:mga0n895_21994_c1 3300050512 Bacteria 5974
175 nmdc:mga0n895_830097_c1 3300050512 Bacteria 913
176 nmdc:mga0rr50_1137263_c1 3300050513 Bacteria 664
177 nmdc:mga0rr50_230492_c1 3300050513 Bacteria 1532
178 Ga0495601_0038659 3300053077 Bacteria 2984
179 Ga0495619_0254539 3300053085 Bacteria 1217
180 Ga0500566_0142862 3300053094 Bacteria 1268
181 Ga0500595_053563 3300053119 Bacteria 1242
182 Ga0500618_005810 3300053125 Bacteria 3705
183 Ga0500559_0031596 3300053136 Bacteria 2272
184 Ga0500564_006376 3300053138 Bacteria 4914
185 Ga0500616_0060130 3300053153 Bacteria 1971
186 Ga0500567_002559 3300053723 Bacteria 7838
187 Ga0500625_000005 3300053729 Bacteria 209509
188 Ga0501084_1408238 3300054114 Bacteria 584
189 Ga0501082_0166432 3300060353 Bacteria 1916
190 Ga0501082_0479644 3300060353 Bacteria 1087
191 2828306550 2828305725 Bacteria 4916900
192 2883295663 2883291878 Bacteria 5894118
193 2883358513 2883354860 Bacteria 5865246
194 Ga0500644_0262600
195 rootH2_10094019
196 rootL2_10025826
197 rootH1_10083037
198 Ga0065704_10078900
199 Ga0065715_10040243
200 Ga0070691_10113037
201 Ga0070714_101006913
202 Ga0070713_100712230
203 Ga0070711_100368994
204 Ga0070662_100305305
205 Ga0070681_10265236
206 Ga0070681_10285401
207 Ga0068853_100060671
208 Ga0070695_100838671
209 Ga0070665_100103429
210 Ga0070704_100043881
211 Ga0068858_100286499
212 Ga0068858_100587933
213 Ga0068862_101522416
214 Ga0081538_10251030
215 Ga0081540_1109609
216 Ga0070712_100000256
217 Ga0070712_100061336
218 Ga0070712_100986162
219 Ga0075428_100407149
220 Ga0075430_100400702
221 Ga0075431_100026840
222 Ga0075433_10500465
223 Ga0075434_100163216
224 Ga0075434_100229513
225 Ga0075434_100435382
226 Ga0075436_100449068
227 Ga0075435_100438049
228 Ga0075435_100756015
229 Ga0099794_10417775
230 Ga0111539_10436622
231 Ga0111539_10680674
232 Ga0105247_10435961
233 Ga0114129_10096278
234 Ga0114129_10911957
235 Ga0114129_10939709
236 Ga0114129_11387942
237 Ga0105237_11310456
238 Ga0105238_10053207
239 Ga0105239_10142727
240 Ga0105246_10568767
241 Ga0157374_10429443
242 Ga0157378_10431892
243 Ga0157375_10742777
244 Ga0163163_10142897
245 Ga0157379_10823504
246 Ga0213876_10112384
247 Ga0213871_10033848
248 Ga0213871_10035806
249 Ga0207693_10000612
250 Ga0207693_10036272
251 Ga0207693_10102592
252 Ga0207693_10641035
253 Ga0207663_10357144
254 Ga0207663_10431233
255 Ga0207657_10557724
256 Ga0207700_10197505
257 Ga0207706_10222277
258 Ga0207706_10831434
259 Ga0207665_10052313
260 Ga0207668_10431061
261 Ga0207703_10247219
262 Ga0207675_100180539
263 Ga0268266_10075738
264 Ga0268265_10391185
265 Ga0265332_10003643
266 Ga0265340_10022623
267 Ga0265331_10015715
268 Ga0265316_10289958
269 Ga0265314_10066573
270 Ga0265342_10000073
271 Ga0373936_0167757
272 Ga0373954_0422328
273 Ga0373943_0044079
274 Ga0373943_0220892
275 Ga0373935_0353502
276 Ga0373927_0025179
277 Ga0373927_0083853
278 Ga0373947_0197402
279 Ga0373937_0367031
280 Ga0395905_0034840
281 Ga0436365_0706147
282 Ga0436360_0048513
283 Ga0436360_0210049
284 Ga0436360_0406283
285 Ga0436360_0720575
286 Ga0436360_0735778
287 Ga0436360_0906656
288 Ga0436361_0664035
289 Ga0436361_0899243
290 Ga0436363_0604503
291 Ga0436362_0786995
292 Ga0436362_0805074
293 Ga0495603_0016204
294 Ga0495629_0000108
295 Ga0495629_0339351
296 Ga0495580_0013675
297 Ga0495582_0009619
298 Ga0495639_0009382
299 Ga0495594_0003239
300 Ga0495666_0063694
301 Ga0495665_0066390
302 Ga0495640_0237257
303 Ga0495622_0012181
304 Ga0495634_0027514
305 Ga0495635_0250792
306 Ga0495588_0007875
307 Ga0495647_0247338
308 Ga0495613_0009164
309 Ga0495624_0105638
310 Ga0495581_0022193
311 Ga0495581_0251321
312 Ga0495672_0168636
313 Ga0495676_0043869
314 Ga0495680_0366077
315 Ga0495684_0590554
316 Ga0495686_0010594
317 Ga0495593_0019537
318 Ga0496100_0193527
319 Ga0496100_0818316
320 Ga0496102_1251753
321 Ga0496103_0235236
322 Ga0496104_0014662
323 Ga0496104_0267555
324 Ga0496105_0003780
325 Ga0496106_0252702
326 Ga0496107_0123878
327 Ga0496107_0278855
328 Ga0496108_0002264
329 Ga0496108_0862190
330 Ga0496109_0004626
331 Ga0496109_0497206
332 Ga0496109_0594234
333 Ga0496110_0012053
334 Ga0496110_0038367
335 Ga0496110_0340727
336 Ga0496111_0040382
337 Ga0496111_0565733
338 Ga0496112_0013269
339 Ga0496112_0619994
340 Ga0496113_0073514
341 Ga0496113_0287078
342 Ga0496113_0793228
343 Ga0496114_0713295
344 Ga0496115_0021231
345 Ga0496115_0967049
346 Ga0496116_0358838
347 Ga0496121_0000087
348 Ga0496124_0221062
349 Ga0496126_0055524
350 Ga0496126_0605454
351 Ga0501033_0005489
352 Ga0501034_0178824
353 Ga0501038_0321002
354 Ga0501043_0328301
355 Ga0501047_0213291
356 Ga0501048_0000326
357 Ga0501069_0116355
358 Ga0501070_0703282
359 Ga0501074_0228145
360 Ga0501080_0133038
361 Ga0501083_0038444
362 nmdc:mga06z11_44946_c1
363 nmdc:mga0qj67_271950_c1
364 nmdc:mga06r32_73969_c1
365 nmdc:mga08y16_1017553_c1
366 nmdc:mga08y16_981487_c1
367 nmdc:mga0n895_21994_c1
368 nmdc:mga0n895_830097_c1
369 nmdc:mga0rr50_1137263_c1
370 nmdc:mga0rr50_230492_c1
371 Ga0495601_0038659
372 Ga0495619_0254539
373 Ga0500566_0142862
374 Ga0500595_053563
375 Ga0500618_005810
376 Ga0500559_0031596
377 Ga0500564_006376
378 Ga0500616_0060130
379 Ga0500567_002559
380 Ga0500625_000005
381 Ga0501084_1408238
382 Ga0501082_0166432
383 Ga0501082_0479644
384 2828306550
385 2883295663
386 2883358513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.8716 47 187
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.839 47 187
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.832 50 184
6e8l-assembly3.cif.gz_F crystal structure of alkyl hydroperoxidase d (ahpd) from streptococcus pneumoniae (strain d39/ nctc 7466) 0.828 9 187
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8166 52 182
ID Description Score Start End Superfamily
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8968 47 187 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8793 58 185 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8572 47 187 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8553 49 185 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8549 58 185 1.20.1290.10
ID Description Score Start End GO Terms
AF-A5EAF3-F1-model_v4 deleted 0.987 1 186
AF-A0A0W0X4D2-F1-model_v4 Carboxymuconolactone decarboxylase 0.9853 1 186
AF-A0A318VBR3-F1-model_v4 deleted 0.9825 1 187
AF-A5EAF3-F1-model_v4 deleted 0.9818 1 186
AF-A0A8A6KTP2-F1-model_v4 deleted 0.9814 77 188

Map