F297550

General Info

Members Datasets Scaffolds Average Seq Length
193 151 386 260

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0046056|Ga0466966_0046056_1086_1907
Length 273
Sequence MTNRGERDAIMSQDNAAPAAALITGGTSGIGLATARLLAQRGHPVFLCARTQEDVDGVVEKLRADGLTAAGLRADITVQQDVENLVAAAVEQYGPLGVLVNNAGRNGGGVTAEIPDELWYSVIETNLNSVFRVTRQVLARGGMRERGWGRIINIASTGGKQGVVFGAPYSAAKHGVVGFTKALGLELATSGITVNAVCPGYVETPLAVKVRQGYADHWGTSQDEVLAKFQAKIPLGRYSTPQEVAGLVGYLTSDTAASITAQALNVCGGLGNY

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
7 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
8 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
9 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
10 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
13 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
19 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
21 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
34 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
35 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
36 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
37 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
38 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
39 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
40 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
41 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
42 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
43 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
44 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
45 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
46 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
47 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
48 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
49 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
50 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
51 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
52 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
53 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
54 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
55 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
56 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
57 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
58 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
61 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
62 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
63 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
64 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
65 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
66 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
67 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
68 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
69 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
70 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
71 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
72 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
73 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
74 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
75 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
78 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
79 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
80 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
81 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
82 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
83 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
86 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
87 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
88 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
89 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
90 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
91 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
92 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
93 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
94 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
123 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
124 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
125 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
126 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
127 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
128 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
129 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
130 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
131 2643221670 Streptomyces sp. Root431 Isolate Unclassified
132 2643221692 Nocardia sp. Root136 Isolate Unclassified
133 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
134 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
135 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
136 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
137 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
138 2862574272 Streptomyces sp. AcE210 Isolate Nodule
139 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
140 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
141 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
142 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
143 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
144 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
145 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
146 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
147 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
148 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
149 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
150 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
151 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.05
Metatranscriptomes 0.52
Isolates 12.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.74
Nodule 3.11
Rhizoplane 6.74
Rhizosphere 72.54
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0046056 3300044684 Bacteria 2786
2 rootH1_10023935 3300003316 Bacteria 13433
3 Ga0070709_10066085 3300005434 Bacteria 2318
4 Ga0070710_10008616 3300005437 Bacteria 4967
5 Ga0070711_100436143 3300005439 Bacteria 1070
6 Ga0070684_100159834 3300005535 Bacteria 2043
7 Ga0068859_100030254 3300005617 Bacteria 5433
8 Ga0068858_100001015 3300005842 Bacteria 28943
9 Ga0070717_10014444 3300006028 Bacteria 6077
10 Ga0070712_100005838 3300006175 Bacteria 7619
11 Ga0070712_100468038 3300006175 Bacteria 1052
12 Ga0075367_10026651 3300006178 Bacteria 3280
13 Ga0075434_100098638 3300006871 Bacteria 2927
14 Ga0097620_100030254 3300006931 Bacteria 5433
15 Ga0105251_10001105 3300009011 Bacteria 23448
16 Ga0105250_10016966 3300009092 Bacteria 2962
17 Ga0105248_10110009 3300009177 Bacteria 3107
18 Ga0105238_10261799 3300009551 Bacteria 1709
19 Ga0157376_10089929 3300014969 Bacteria 2656
20 Ga0247550_100462 3300023660 Bacteria 1060
21 Ga0207426_1001060 3300025302 Bacteria 26047
22 Ga0207426_1023663 3300025302 Bacteria 2094
23 Ga0207696_1037594 3300025711 Bacteria 1432
24 Ga0207713_1006762 3300025735 Bacteria 6921
25 Ga0207692_10000328 3300025898 Bacteria 16429
26 Ga0207699_10015163 3300025906 Bacteria 3999
27 Ga0207699_10075908 3300025906 Bacteria 2069
28 Ga0207693_10004063 3300025915 Bacteria 12437
29 Ga0207693_10415307 3300025915 Bacteria 1052
30 Ga0207694_10492713 3300025924 Bacteria 1026
31 Ga0207700_10009338 3300025928 Bacteria 6121
32 Ga0207664_10001611 3300025929 Bacteria 14834
33 Ga0207664_10358067 3300025929 Bacteria 1292
34 Ga0207664_10566014 3300025929 Bacteria 1020
35 Ga0207711_10097134 3300025941 Bacteria 2601
36 Ga0207703_10115319 3300026035 Bacteria 2298
37 Ga0207702_10075076 3300026078 Bacteria 2920
38 Ga0207702_10275835 3300026078 Bacteria 1587
39 Ga0209371_1034148 3300027312 Bacteria 1080
40 Ga0209813_10004021 3300027866 Bacteria 3484
41 Ga0307515_10017498 3300028794 Bacteria 13048
42 Ga0307515_10095060 3300028794 Bacteria 3673
43 Ga0307511_10006650 3300030521 Bacteria 11660
44 Ga0265340_10000362 3300031247 Bacteria 24187
45 Ga0307513_10081382 3300031456 Bacteria 3337
46 Ga0307513_10250490 3300031456 Bacteria 1568
47 Ga0307509_10055189 3300031507 Bacteria 4224
48 Ga0307516_10005382 3300031730 Bacteria 15377
49 Ga0307411_10120167 3300032005 Bacteria 1899
50 Ga0307507_10039522 3300033179 Bacteria 4760
51 Ga0307510_10004748 3300033180 Bacteria 16077
52 Ga0451795_1200842 3300041456 Bacteria 1290
53 Ga0451798_0854837 3300041458 Unclassified 965
54 Ga0451833_0507689 3300041491 Bacteria 852
55 Ga0439433_0008131 3300041999 Bacteria 2271
56 Ga0439449_0048001 3300042007 Bacteria 1581
57 Ga0439457_000121 3300042014 Bacteria 19113
58 Ga0466969_0014080 3300044656 Bacteria 4208
59 Ga0466969_0047277 3300044656 Bacteria 2130
60 Ga0466966_0028299 3300044684 Bacteria 3651
61 Ga0466966_0059804 3300044684 Bacteria 2406
62 Ga0466961_0044576 3300044693 Bacteria 2838
63 Ga0466961_0184839 3300044693 Bacteria 1293
64 Ga0466963_0219282 3300044694 Bacteria 1332
65 Ga0466971_0017644 3300044719 Bacteria 3159
66 Ga0466971_0038482 3300044719 Bacteria 2146
67 Ga0466971_0051594 3300044719 Bacteria 1852
68 Ga0466968_0000385 3300044735 Bacteria 14482
69 Ga0466970_0057919 3300044765 Bacteria 2073
70 Ga0466957_0328009 3300044842 Bacteria 1034
71 Ga0466960_0066582 3300044901 Bacteria 1782
72 Ga0466959_0008416 3300045049 Bacteria 7292
73 Ga0466959_0039426 3300045049 Bacteria 3490
74 Ga0466958_0061482 3300045836 Bacteria 2288
75 Ga0466958_0139454 3300045836 Bacteria 1526
76 Ga0466967_0010128 3300045976 Bacteria 7051
77 Ga0495603_0040183 3300046455 Bacteria 2800
78 Ga0495603_0065671 3300046455 Bacteria 2138
79 Ga0495629_0003185 3300046459 Bacteria 12427
80 Ga0495629_0004480 3300046459 Bacteria 10463
81 Ga0495638_0151789 3300046460 Bacteria 1343
82 Ga0495651_0281531 3300046462 Bacteria 1123
83 Ga0495582_0003614 3300046473 Bacteria 8713
84 Ga0495662_0000488 3300046476 Bacteria 18081
85 Ga0495662_0015552 3300046476 Bacteria 3693
86 Ga0495585_0122276 3300046492 Bacteria 1376
87 Ga0495594_0008229 3300046499 Bacteria 5367
88 Ga0495594_0017799 3300046499 Bacteria 3758
89 Ga0495631_0030447 3300046518 Bacteria 2448
90 Ga0495640_0028499 3300046533 Bacteria 4020
91 Ga0495645_0026914 3300046543 Bacteria 4177
92 Ga0495622_0003306 3300046557 Bacteria 7621
93 Ga0495611_0011171 3300046648 Bacteria 3806
94 Ga0495625_0101064 3300046660 Bacteria 1981
95 Ga0495625_0137810 3300046660 Bacteria 1648
96 Ga0495588_0048239 3300046674 Bacteria 2187
97 Ga0495657_0001240 3300046675 Bacteria 22317
98 Ga0495613_0005180 3300046689 Bacteria 9789
99 Ga0495613_0016514 3300046689 Bacteria 5496
100 Ga0495624_0037783 3300046690 Bacteria 3105
101 Ga0495670_0013346 3300046691 Bacteria 4042
102 Ga0495670_0227668 3300046691 Bacteria 991
103 Ga0495671_0022663 3300046692 Bacteria 3288
104 Ga0495671_0034922 3300046692 Bacteria 2555
105 Ga0495649_0014843 3300046694 Bacteria 4451
106 Ga0495589_0006219 3300046794 Bacteria 6305
107 Ga0495660_0100222 3300046810 Bacteria 1492
108 Ga0495581_0002400 3300047315 Bacteria 10583
109 Ga0495581_0128900 3300047315 Bacteria 1474
110 Ga0495604_0002682 3300047317 Bacteria 14277
111 Ga0495636_0000145 3300047318 Bacteria 28558
112 Ga0495636_0088681 3300047318 Bacteria 1341
113 Ga0495676_0031884 3300047321 Bacteria 4452
114 Ga0495676_0115257 3300047321 Bacteria 1965
115 Ga0495683_0019679 3300047323 Bacteria 3484
116 Ga0495683_0073222 3300047323 Bacteria 1680
117 Ga0495687_002907 3300047443 Bacteria 13048
118 Ga0495675_0007661 3300047444 Bacteria 6658
119 Ga0495677_0026568 3300047445 Bacteria 2100
120 Ga0495685_000374 3300047447 Bacteria 14277
121 Ga0495685_000632 3300047447 Bacteria 10777
122 Ga0495685_001073 3300047447 Bacteria 8335
123 Ga0495685_001529 3300047447 Bacteria 7093
124 Ga0495685_016254 3300047447 Bacteria 2541
125 Ga0495681_0018263 3300047470 Bacteria 3867
126 Ga0495593_0024785 3300047673 Bacteria 3321
127 Ga0495614_0023035 3300048089 Bacteria 2686
128 Ga0495614_0098160 3300048089 Bacteria 1278
129 Ga0496100_0011018 3300048903 Bacteria 5129
130 Ga0496101_0051277 3300048904 Bacteria 2973
131 Ga0496102_0281593 3300048905 Bacteria 1567
132 Ga0496103_0432236 3300048906 Bacteria 845
133 Ga0496104_0199453 3300048907 Bacteria 1913
134 Ga0496106_0109343 3300048909 Bacteria 2151
135 Ga0496107_0131952 3300048910 Bacteria 1844
136 Ga0496109_0080364 3300048912 Bacteria 3003
137 Ga0496110_0021188 3300048913 Bacteria 5497
138 Ga0496113_0037965 3300048916 Bacteria 3538
139 Ga0496118_0097509 3300048921 Bacteria 2000
140 Ga0496119_0071972 3300048922 Bacteria 2022
141 Ga0501031_0027037 3300049568 Bacteria 3740
142 Ga0501031_0362205 3300049568 Bacteria 938
143 Ga0501032_0013305 3300049569 Bacteria 5857
144 Ga0501036_0236604 3300049572 Bacteria 1532
145 Ga0501038_0106258 3300049574 Bacteria 2330
146 Ga0501039_0216562 3300049575 Bacteria 1506
147 Ga0501043_0039516 3300049579 Bacteria 3707
148 Ga0501047_0067859 3300049581 Bacteria 3436
149 Ga0501047_0076841 3300049581 Bacteria 3213
150 Ga0501047_0297612 3300049581 Bacteria 1456
151 Ga0501048_0100632 3300049582 Bacteria 2039
152 Ga0501073_0189539 3300049589 Bacteria 1423
153 Ga0501080_0199662 3300049742 Bacteria 1836
154 Ga0501035_0104055 3300049822 Bacteria 2489
155 Ga0501044_0128161 3300049823 Bacteria 2533
156 Ga0501044_0219037 3300049823 Bacteria 1854
157 nmdc:mga06z11_14796_c1 3300050494 Bacteria 3465
158 nmdc:mga04h51_9172_c1 3300050495 Bacteria 1014
159 nmdc:mga0n895_263395_c1 3300050512 Bacteria 1749
160 Ga0495655_0035060 3300053083 Bacteria 1246
161 Ga0500644_0068565 3300053088 Bacteria 1271
162 Ga0500566_0087775 3300053094 Bacteria 1722
163 Ga0500558_116613 3300053106 Bacteria 1040
164 Ga0500560_004657 3300053107 Bacteria 2944
165 Ga0500560_014700 3300053107 Bacteria 2093
166 Ga0500614_005031 3300053123 Bacteria 2778
167 Ga0500573_0159060 3300053140 Bacteria 1231
168 Ga0466962_0006373 3300061719 Bacteria 5666
169 Ga0466962_0021477 3300061719 Bacteria 3099
170 2547412776 2547132111 Bacteria 8013147
171 2644385027 2643221670 Bacteria 6497041
172 2644515927 2643221692 Bacteria 7282860
173 2785343626 2784746763 Bacteria 9783172
174 2795784910 2795385470 Bacteria 8317180
175 2808916576 2808606375 Bacteria 9466072
176 2862182517 2862178590 Bacteria 8583590
177 2862387780 2862382967 Bacteria 10317375
178 2862388192 2862382967 Bacteria 10317375
179 2862577068 2862574272 Bacteria 10567477
180 2877683767 2877676314 Bacteria 9512378
181 2912720251 2912715099 Bacteria 9460473
182 2954696929 2954691527 Bacteria 10720516
183 2954705206 2954701450 Bacteria 10834262
184 8008565515 8008558824 Bacteria 10610750
185 8008567146 8008558824 Bacteria 10610750
186 8033688163 8033684223 Bacteria 6906479
187 8047903952 8047893842 Bacteria 11723082
188 8048379544 8048369669 Bacteria 11666822
189 8048389706 8048379754 Bacteria 11877923
190 8048408318 8048406513 Bacteria 8936924
191 8054917524 8054913762 Bacteria 7713009
192 8056060315 8056060235 Bacteria 7259403
193 8056214900 8056207758 Bacteria 8639239
194 Ga0466966_0046056
195 rootH1_10023935
196 Ga0070709_10066085
197 Ga0070710_10008616
198 Ga0070711_100436143
199 Ga0070684_100159834
200 Ga0068859_100030254
201 Ga0068858_100001015
202 Ga0070717_10014444
203 Ga0070712_100005838
204 Ga0070712_100468038
205 Ga0075367_10026651
206 Ga0075434_100098638
207 Ga0097620_100030254
208 Ga0105251_10001105
209 Ga0105250_10016966
210 Ga0105248_10110009
211 Ga0105238_10261799
212 Ga0157376_10089929
213 Ga0247550_100462
214 Ga0207426_1001060
215 Ga0207426_1023663
216 Ga0207696_1037594
217 Ga0207713_1006762
218 Ga0207692_10000328
219 Ga0207699_10015163
220 Ga0207699_10075908
221 Ga0207693_10004063
222 Ga0207693_10415307
223 Ga0207694_10492713
224 Ga0207700_10009338
225 Ga0207664_10001611
226 Ga0207664_10358067
227 Ga0207664_10566014
228 Ga0207711_10097134
229 Ga0207703_10115319
230 Ga0207702_10075076
231 Ga0207702_10275835
232 Ga0209371_1034148
233 Ga0209813_10004021
234 Ga0307515_10017498
235 Ga0307515_10095060
236 Ga0307511_10006650
237 Ga0265340_10000362
238 Ga0307513_10081382
239 Ga0307513_10250490
240 Ga0307509_10055189
241 Ga0307516_10005382
242 Ga0307411_10120167
243 Ga0307507_10039522
244 Ga0307510_10004748
245 Ga0451795_1200842
246 Ga0451798_0854837
247 Ga0451833_0507689
248 Ga0439433_0008131
249 Ga0439449_0048001
250 Ga0439457_000121
251 Ga0466969_0014080
252 Ga0466969_0047277
253 Ga0466966_0028299
254 Ga0466966_0059804
255 Ga0466961_0044576
256 Ga0466961_0184839
257 Ga0466963_0219282
258 Ga0466971_0017644
259 Ga0466971_0038482
260 Ga0466971_0051594
261 Ga0466968_0000385
262 Ga0466970_0057919
263 Ga0466957_0328009
264 Ga0466960_0066582
265 Ga0466959_0008416
266 Ga0466959_0039426
267 Ga0466958_0061482
268 Ga0466958_0139454
269 Ga0466967_0010128
270 Ga0495603_0040183
271 Ga0495603_0065671
272 Ga0495629_0003185
273 Ga0495629_0004480
274 Ga0495638_0151789
275 Ga0495651_0281531
276 Ga0495582_0003614
277 Ga0495662_0000488
278 Ga0495662_0015552
279 Ga0495585_0122276
280 Ga0495594_0008229
281 Ga0495594_0017799
282 Ga0495631_0030447
283 Ga0495640_0028499
284 Ga0495645_0026914
285 Ga0495622_0003306
286 Ga0495611_0011171
287 Ga0495625_0101064
288 Ga0495625_0137810
289 Ga0495588_0048239
290 Ga0495657_0001240
291 Ga0495613_0005180
292 Ga0495613_0016514
293 Ga0495624_0037783
294 Ga0495670_0013346
295 Ga0495670_0227668
296 Ga0495671_0022663
297 Ga0495671_0034922
298 Ga0495649_0014843
299 Ga0495589_0006219
300 Ga0495660_0100222
301 Ga0495581_0002400
302 Ga0495581_0128900
303 Ga0495604_0002682
304 Ga0495636_0000145
305 Ga0495636_0088681
306 Ga0495676_0031884
307 Ga0495676_0115257
308 Ga0495683_0019679
309 Ga0495683_0073222
310 Ga0495687_002907
311 Ga0495675_0007661
312 Ga0495677_0026568
313 Ga0495685_000374
314 Ga0495685_000632
315 Ga0495685_001073
316 Ga0495685_001529
317 Ga0495685_016254
318 Ga0495681_0018263
319 Ga0495593_0024785
320 Ga0495614_0023035
321 Ga0495614_0098160
322 Ga0496100_0011018
323 Ga0496101_0051277
324 Ga0496102_0281593
325 Ga0496103_0432236
326 Ga0496104_0199453
327 Ga0496106_0109343
328 Ga0496107_0131952
329 Ga0496109_0080364
330 Ga0496110_0021188
331 Ga0496113_0037965
332 Ga0496118_0097509
333 Ga0496119_0071972
334 Ga0501031_0027037
335 Ga0501031_0362205
336 Ga0501032_0013305
337 Ga0501036_0236604
338 Ga0501038_0106258
339 Ga0501039_0216562
340 Ga0501043_0039516
341 Ga0501047_0067859
342 Ga0501047_0076841
343 Ga0501047_0297612
344 Ga0501048_0100632
345 Ga0501073_0189539
346 Ga0501080_0199662
347 Ga0501035_0104055
348 Ga0501044_0128161
349 Ga0501044_0219037
350 nmdc:mga06z11_14796_c1
351 nmdc:mga04h51_9172_c1
352 nmdc:mga0n895_263395_c1
353 Ga0495655_0035060
354 Ga0500644_0068565
355 Ga0500566_0087775
356 Ga0500558_116613
357 Ga0500560_004657
358 Ga0500560_014700
359 Ga0500614_005031
360 Ga0500573_0159060
361 Ga0466962_0006373
362 Ga0466962_0021477
363 2547412776
364 2644385027
365 2644515927
366 2785343626
367 2795784910
368 2808916576
369 2862182517
370 2862387780
371 2862388192
372 2862577068
373 2877683767
374 2912720251
375 2954696929
376 2954705206
377 8008565515
378 8008567146
379 8033688163
380 8047903952
381 8048379544
382 8048389706
383 8048408318
384 8054917524
385 8056060315
386 8056214900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

19

215

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

25

271

0.95

PF08659

KR

KR domain

19

194

0.85

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

21

174

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7emg-assembly1.cif.gz_A carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with nadp+ 0.9637 7 257
2rh4-assembly1.cif.gz_B actinorhodin ketoreductase, actkr, with nadph and inhibitor emodin 0.9599 1 261
1x7g-assembly1.cif.gz_B-2 actinorhodin polyketide ketoreductase, act kr, with nadp bound 0.9587 1 261
3qrw-assembly1.cif.gz_B actinorhodin polyketide ketoreductase mutant p94l bound to nadph 0.9584 1 261
1xr3-assembly1.cif.gz_B-2 actinorhodin polyketide ketoreductase with nadp and the inhibitor isoniazid bound 0.9583 1 261
ID Description Score Start End Superfamily
2rhcB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9602 1 261 3.40.50.720
2rhcB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9566 1 261 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9532 7 87 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9521 7 257 3.40.50.720
3wyeB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9471 7 257 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2N0QKI9-F1-model_v4 NAD(P)-binding protein 0.9838 7 125 GO:0005829
GO:0009688
GO:0010301
AF-A0A1M3BLS1-F1-model_v4 3-ketoacyl-ACP reductase 0.9601 9 257 GO:0016616
AF-A0A559M6V2-F1-model_v4 Putative oxidoreductase 0.9596 7 95 GO:0016491
AF-A0A5B6TPA1-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase 0.951 6 256 GO:0016491
AF-A0A3S1HKC7-F1-model_v4 SDR family oxidoreductase 0.9497 135 257 GO:0016616

Map