F297477

General Info

Members Datasets Scaffolds Average Seq Length
193 120 386 151

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1283457|Ga0436364_1283457_1323_1775
Length 150
Sequence MRAGGDFRLPDEARTTRLGAAIGAALRGGEAVCLDGPLGAGKSVLARGVVRAIAPDEADIPSPTFTLAQAYPGRLLLIHFDLWRIKSAEEAFEIGLDDGLAHGAAVIEWAERLGHHRPTDRLDVELSIDGEARRARLTPHGAWECRPLEL

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
101 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
113 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
114 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
115 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
116 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
117 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
118 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
119 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
120 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.18
Nodule 0
Rhizoplane 3.11
Rhizosphere 84.97
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1283457 3300037853 Bacteria 1812
2 Ga0070658_10037438 3300005327 Bacteria 3911
3 Ga0070658_10592446 3300005327 Bacteria 961
4 Ga0070670_100008284 3300005331 Bacteria 8852
5 Ga0070670_100086221 3300005331 Bacteria 2698
6 Ga0068869_100147635 3300005334 Bacteria 1821
7 Ga0070666_10850232 3300005335 Bacteria 673
8 Ga0070668_100001210 3300005347 Bacteria 18336
9 Ga0070669_100026354 3300005353 Bacteria 4182
10 Ga0070669_100384588 3300005353 Bacteria 1145
11 Ga0070671_100002674 3300005355 Bacteria 13814
12 Ga0070674_101240330 3300005356 Bacteria 663
13 Ga0070667_100003061 3300005367 Bacteria 14375
14 Ga0070667_100006181 3300005367 Bacteria 9958
15 Ga0070678_100158557 3300005456 Bacteria 1831
16 Ga0070679_100854784 3300005530 Bacteria 853
17 Ga0070684_101829055 3300005535 Bacteria 573
18 Ga0068853_100253081 3300005539 Bacteria 1617
19 Ga0068853_100389385 3300005539 Bacteria 1303
20 Ga0070665_100000744 3300005548 Bacteria 43397
21 Ga0070665_100041740 3300005548 Bacteria 4612
22 Ga0070665_100824251 3300005548 Bacteria 941
23 Ga0070665_101768392 3300005548 Bacteria 625
24 Ga0068854_101051456 3300005578 Bacteria 723
25 Ga0068856_100216646 3300005614 Bacteria 1930
26 Ga0068864_100249385 3300005618 Bacteria 1648
27 Ga0068864_100424695 3300005618 Bacteria 1267
28 Ga0068861_100009086 3300005719 Bacteria 6852
29 Ga0068861_100036609 3300005719 Bacteria 3644
30 Ga0068863_100153548 3300005841 Bacteria 2203
31 Ga0068863_100360982 3300005841 Bacteria 1416
32 Ga0068863_100514386 3300005841 Bacteria 1180
33 Ga0068858_100054918 3300005842 Bacteria 3683
34 Ga0068858_100103393 3300005842 Bacteria 2657
35 Ga0068860_100004156 3300005843 Bacteria 14835
36 Ga0068860_100059175 3300005843 Bacteria 3643
37 Ga0068862_100007639 3300005844 Bacteria 8954
38 Ga0068862_100009027 3300005844 Bacteria 8252
39 Ga0068862_100058238 3300005844 Bacteria 3314
40 Ga0068862_100087326 3300005844 Bacteria 2713
41 Ga0068862_100215396 3300005844 Bacteria 1737
42 Ga0068862_100223310 3300005844 Bacteria 1706
43 Ga0070717_10018865 3300006028 Bacteria 5396
44 Ga0075363_100073555 3300006048 Bacteria 1860
45 Ga0075362_10021841 3300006177 Bacteria 2691
46 Ga0068865_100002000 3300006881 Bacteria 12032
47 Ga0105240_10004603 3300009093 Bacteria 20903
48 Ga0105240_10059060 3300009093 Bacteria 4787
49 Ga0111539_12356840 3300009094 Bacteria 618
50 Ga0105248_10005197 3300009177 Bacteria 14344
51 Ga0105248_10941319 3300009177 Bacteria 976
52 Ga0105237_10307608 3300009545 Bacteria 1588
53 Ga0105238_10014790 3300009551 Bacteria 7891
54 Ga0105238_10156273 3300009551 Bacteria 2256
55 Ga0105238_10711023 3300009551 Bacteria 1017
56 Ga0105238_10794448 3300009551 Bacteria 962
57 Ga0105238_11006322 3300009551 Bacteria 854
58 Ga0105249_10389186 3300009553 Bacteria 1422
59 Ga0105246_10905048 3300011119 Bacteria 791
60 Ga0163162_10678194 3300013306 Bacteria 1153
61 Ga0163163_10000747 3300014325 Bacteria 27697
62 Ga0163163_10074597 3300014325 Bacteria 3385
63 Ga0163163_10518464 3300014325 Bacteria 1254
64 Ga0163163_10681087 3300014325 Bacteria 1092
65 Ga0213872_10153877 3300021361 Bacteria 1003
66 Ga0213876_10000130 3300021384 Bacteria 81967
67 Ga0209148_1009345 3300025254 Bacteria 1914
68 Ga0209148_1026977 3300025254 Bacteria 887
69 Ga0207680_10740181 3300025903 Bacteria 705
70 Ga0207705_10555864 3300025909 Bacteria 892
71 Ga0207695_10009804 3300025913 Bacteria 11773
72 Ga0207695_10034886 3300025913 Bacteria 5463
73 Ga0207681_10110892 3300025923 Bacteria 1995
74 Ga0207694_10756145 3300025924 Bacteria 820
75 Ga0207650_10030143 3300025925 Bacteria 3905
76 Ga0207644_10001773 3300025931 Bacteria 13962
77 Ga0207704_10001149 3300025938 Bacteria 11769
78 Ga0207711_10025925 3300025941 Bacteria 4917
79 Ga0207711_10462126 3300025941 Bacteria 1182
80 Ga0207689_10105061 3300025942 Bacteria 2320
81 Ga0207661_10868418 3300025944 Bacteria 831
82 Ga0207679_10770427 3300025945 Bacteria 876
83 Ga0207667_10632191 3300025949 Bacteria 1077
84 Ga0207667_10967617 3300025949 Bacteria 840
85 Ga0207712_10033659 3300025961 Bacteria 3466
86 Ga0207668_10000019 3300025972 Bacteria 152108
87 Ga0207668_10003918 3300025972 Bacteria 8777
88 Ga0207668_10019413 3300025972 Bacteria 4297
89 Ga0207658_10004069 3300025986 Bacteria 10210
90 Ga0207658_10013465 3300025986 Bacteria 5588
91 Ga0207658_10369010 3300025986 Bacteria 1254
92 Ga0207703_10015104 3300026035 Bacteria 6027
93 Ga0207703_10159608 3300026035 Bacteria 1974
94 Ga0207639_10164112 3300026041 Bacteria 1875
95 Ga0207702_10405452 3300026078 Bacteria 1315
96 Ga0207641_10012386 3300026088 Bacteria 6996
97 Ga0207641_10433136 3300026088 Bacteria 1268
98 Ga0207676_10128697 3300026095 Bacteria 2149
99 Ga0207676_10289705 3300026095 Bacteria 1490
100 Ga0207674_10391631 3300026116 Bacteria 1343
101 Ga0207675_100017063 3300026118 Bacteria 6783
102 Ga0207675_100123737 3300026118 Bacteria 2449
103 Ga0207675_100477324 3300026118 Bacteria 1239
104 Ga0207698_10709654 3300026142 Bacteria 1001
105 Ga0209981_1000889 3300027378 Bacteria 3748
106 Ga0209999_1080023 3300027543 Bacteria 630
107 Ga0209983_1004252 3300027665 Bacteria 3018
108 Ga0268266_10000611 3300028379 Bacteria 48682
109 Ga0268266_10161008 3300028379 Bacteria 2030
110 Ga0268266_11609336 3300028379 Unclassified 625
111 Ga0268265_10032615 3300028380 Bacteria 3777
112 Ga0268265_10630063 3300028380 Bacteria 1028
113 Ga0268265_10728792 3300028380 Bacteria 960
114 Ga0268264_10056522 3300028381 Bacteria 3281
115 Ga0268264_10220057 3300028381 Bacteria 1747
116 Ga0265334_10058058 3300028573 Bacteria 1465
117 Ga0265338_10034808 3300028800 Bacteria 4856
118 Ga0265331_10309638 3300031250 Bacteria 707
119 Ga0265327_10002013 3300031251 Bacteria 22950
120 Ga0265327_10008144 3300031251 Bacteria 7882
121 Ga0265327_10185517 3300031251 Bacteria 949
122 Ga0307513_10000069 3300031456 Bacteria 140558
123 Ga0307513_10006209 3300031456 Bacteria 15662
124 Ga0307408_101778080 3300031548 Bacteria 589
125 Ga0307508_10413115 3300031616 Bacteria 941
126 Ga0265342_10422924 3300031712 Bacteria 686
127 Ga0307516_10000030 3300031730 Bacteria 159694
128 Ga0307413_10902696 3300031824 Bacteria 750
129 Ga0307410_10266614 3300031852 Bacteria 1338
130 Ga0373944_0053797 3300035089 Bacteria 1275
131 Ga0373935_1022191 3300035692 Bacteria 614
132 Ga0373927_0779397 3300035695 Bacteria 632
133 Ga0373947_0850387 3300035725 Bacteria 623
134 Ga0373925_0179004 3300037068 Bacteria 1677
135 Ga0395899_0085503 3300037312 Bacteria 2291
136 Ga0395899_0164726 3300037312 Bacteria 1564
137 Ga0395900_0015049 3300037418 Bacteria 7885
138 Ga0395900_0046664 3300037418 Bacteria 4461
139 Ga0395898_0007710 3300037466 Bacteria 11430
140 Ga0395898_0011260 3300037466 Bacteria 9305
141 Ga0395898_0298636 3300037466 Bacteria 1536
142 Ga0395905_0016223 3300037471 Bacteria 7076
143 Ga0395905_0043880 3300037471 Bacteria 4196
144 Ga0395905_0047425 3300037471 Bacteria 4026
145 Ga0395905_0797590 3300037471 Bacteria 847
146 Ga0395905_1786944 3300037471 Unclassified 520
147 Ga0436364_1099936 3300037853 Bacteria 1806
148 Ga0395901_0059011 3300038443 Bacteria 3991
149 Ga0395901_0604413 3300038443 Bacteria 1105
150 Ga0395901_0629943 3300038443 Bacteria 1078
151 Ga0395901_0662785 3300038443 Bacteria 1045
152 Ga0436365_0031959 3300039437 Bacteria 106267
153 Ga0436360_0461084 3300039438 Bacteria 851
154 Ga0436360_0779723 3300039438 Bacteria 817
155 Ga0436361_0527642 3300039447 Bacteria 14481
156 Ga0436363_0213785 3300039450 Bacteria 1503
157 Ga0436363_0575092 3300039450 Bacteria 2135
158 Ga0436362_0750917 3300039453 Bacteria 697
159 Ga0436362_1031982 3300039453 Bacteria 827
160 Ga0466971_0437761 3300044719 Bacteria 640
161 Ga0495628_0215897 3300046516 Bacteria 1442
162 Ga0495621_0404079 3300046539 Bacteria 580
163 Ga0495645_0144522 3300046543 Bacteria 1657
164 Ga0495669_0000081 3300046684 Bacteria 63806
165 Ga0495677_0008222 3300047445 Bacteria 3878
166 Ga0496112_0392888 3300048915 Bacteria 1327
167 Ga0496112_0619858 3300048915 Bacteria 1013
168 Ga0496112_0630685 3300048915 Bacteria 1002
169 Ga0496115_0002756 3300048918 Bacteria 12629
170 Ga0496115_0037079 3300048918 Bacteria 3863
171 Ga0496115_0554870 3300048918 Bacteria 918
172 Ga0501033_0022110 3300049570 Bacteria 4798
173 Ga0501034_0009704 3300049571 Bacteria 10064
174 Ga0501034_0502402 3300049571 Bacteria 1126
175 Ga0501036_0881924 3300049572 Bacteria 735
176 Ga0501047_0038789 3300049581 Bacteria 4609
177 Ga0501047_0306499 3300049581 Bacteria 1429
178 Ga0501047_0658803 3300049581 Bacteria 866
179 Ga0501048_0068261 3300049582 Bacteria 2512
180 Ga0501048_0646362 3300049582 Bacteria 759
181 Ga0501048_1237024 3300049582 Bacteria 537
182 Ga0501257_002267 3300049686 Bacteria 4035
183 Ga0501035_0083967 3300049822 Bacteria 2809
184 Ga0501044_0006907 3300049823 Bacteria 12498
185 Ga0500647_0046518 3300053091 Bacteria 2085
186 Ga0500641_0004490 3300053096 Bacteria 4930
187 Ga0500562_006590 3300053108 Bacteria 2926
188 Ga0500597_262061 3300053120 Bacteria 703
189 Ga0500608_073431 3300053122 Bacteria 1624
190 Ga0500552_004510 3300053733 Bacteria 1470
191 2644087340 2643221614 Bacteria 4260023
192 2644344616 2643221661 Bacteria 4267604
193 2644366700 2643221666 Bacteria 4265935
194 Ga0436364_1283457
195 Ga0070658_10037438
196 Ga0070658_10592446
197 Ga0070670_100008284
198 Ga0070670_100086221
199 Ga0068869_100147635
200 Ga0070666_10850232
201 Ga0070668_100001210
202 Ga0070669_100026354
203 Ga0070669_100384588
204 Ga0070671_100002674
205 Ga0070674_101240330
206 Ga0070667_100003061
207 Ga0070667_100006181
208 Ga0070678_100158557
209 Ga0070679_100854784
210 Ga0070684_101829055
211 Ga0068853_100253081
212 Ga0068853_100389385
213 Ga0070665_100000744
214 Ga0070665_100041740
215 Ga0070665_100824251
216 Ga0070665_101768392
217 Ga0068854_101051456
218 Ga0068856_100216646
219 Ga0068864_100249385
220 Ga0068864_100424695
221 Ga0068861_100009086
222 Ga0068861_100036609
223 Ga0068863_100153548
224 Ga0068863_100360982
225 Ga0068863_100514386
226 Ga0068858_100054918
227 Ga0068858_100103393
228 Ga0068860_100004156
229 Ga0068860_100059175
230 Ga0068862_100007639
231 Ga0068862_100009027
232 Ga0068862_100058238
233 Ga0068862_100087326
234 Ga0068862_100215396
235 Ga0068862_100223310
236 Ga0070717_10018865
237 Ga0075363_100073555
238 Ga0075362_10021841
239 Ga0068865_100002000
240 Ga0105240_10004603
241 Ga0105240_10059060
242 Ga0111539_12356840
243 Ga0105248_10005197
244 Ga0105248_10941319
245 Ga0105237_10307608
246 Ga0105238_10014790
247 Ga0105238_10156273
248 Ga0105238_10711023
249 Ga0105238_10794448
250 Ga0105238_11006322
251 Ga0105249_10389186
252 Ga0105246_10905048
253 Ga0163162_10678194
254 Ga0163163_10000747
255 Ga0163163_10074597
256 Ga0163163_10518464
257 Ga0163163_10681087
258 Ga0213872_10153877
259 Ga0213876_10000130
260 Ga0209148_1009345
261 Ga0209148_1026977
262 Ga0207680_10740181
263 Ga0207705_10555864
264 Ga0207695_10009804
265 Ga0207695_10034886
266 Ga0207681_10110892
267 Ga0207694_10756145
268 Ga0207650_10030143
269 Ga0207644_10001773
270 Ga0207704_10001149
271 Ga0207711_10025925
272 Ga0207711_10462126
273 Ga0207689_10105061
274 Ga0207661_10868418
275 Ga0207679_10770427
276 Ga0207667_10632191
277 Ga0207667_10967617
278 Ga0207712_10033659
279 Ga0207668_10000019
280 Ga0207668_10003918
281 Ga0207668_10019413
282 Ga0207658_10004069
283 Ga0207658_10013465
284 Ga0207658_10369010
285 Ga0207703_10015104
286 Ga0207703_10159608
287 Ga0207639_10164112
288 Ga0207702_10405452
289 Ga0207641_10012386
290 Ga0207641_10433136
291 Ga0207676_10128697
292 Ga0207676_10289705
293 Ga0207674_10391631
294 Ga0207675_100017063
295 Ga0207675_100123737
296 Ga0207675_100477324
297 Ga0207698_10709654
298 Ga0209981_1000889
299 Ga0209999_1080023
300 Ga0209983_1004252
301 Ga0268266_10000611
302 Ga0268266_10161008
303 Ga0268266_11609336
304 Ga0268265_10032615
305 Ga0268265_10630063
306 Ga0268265_10728792
307 Ga0268264_10056522
308 Ga0268264_10220057
309 Ga0265334_10058058
310 Ga0265338_10034808
311 Ga0265331_10309638
312 Ga0265327_10002013
313 Ga0265327_10008144
314 Ga0265327_10185517
315 Ga0307513_10000069
316 Ga0307513_10006209
317 Ga0307408_101778080
318 Ga0307508_10413115
319 Ga0265342_10422924
320 Ga0307516_10000030
321 Ga0307413_10902696
322 Ga0307410_10266614
323 Ga0373944_0053797
324 Ga0373935_1022191
325 Ga0373927_0779397
326 Ga0373947_0850387
327 Ga0373925_0179004
328 Ga0395899_0085503
329 Ga0395899_0164726
330 Ga0395900_0015049
331 Ga0395900_0046664
332 Ga0395898_0007710
333 Ga0395898_0011260
334 Ga0395898_0298636
335 Ga0395905_0016223
336 Ga0395905_0043880
337 Ga0395905_0047425
338 Ga0395905_0797590
339 Ga0395905_1786944
340 Ga0436364_1099936
341 Ga0395901_0059011
342 Ga0395901_0604413
343 Ga0395901_0629943
344 Ga0395901_0662785
345 Ga0436365_0031959
346 Ga0436360_0461084
347 Ga0436360_0779723
348 Ga0436361_0527642
349 Ga0436363_0213785
350 Ga0436363_0575092
351 Ga0436362_0750917
352 Ga0436362_1031982
353 Ga0466971_0437761
354 Ga0495628_0215897
355 Ga0495621_0404079
356 Ga0495645_0144522
357 Ga0495669_0000081
358 Ga0495677_0008222
359 Ga0496112_0392888
360 Ga0496112_0619858
361 Ga0496112_0630685
362 Ga0496115_0002756
363 Ga0496115_0037079
364 Ga0496115_0554870
365 Ga0501033_0022110
366 Ga0501034_0009704
367 Ga0501034_0502402
368 Ga0501036_0881924
369 Ga0501047_0038789
370 Ga0501047_0306499
371 Ga0501047_0658803
372 Ga0501048_0068261
373 Ga0501048_0646362
374 Ga0501048_1237024
375 Ga0501257_002267
376 Ga0501035_0083967
377 Ga0501044_0006907
378 Ga0500647_0046518
379 Ga0500641_0004490
380 Ga0500562_006590
381 Ga0500597_262061
382 Ga0500608_073431
383 Ga0500552_004510
384 2644087340
385 2644344616
386 2644366700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02367

TsaE

Threonylcarbamoyl adenosine biosynthesis protein TsaE

9

136

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mvr-assembly1.cif.gz_A crystal structure of bacillus subtilus ydib 0.8839 1 136
5np9-assembly1.cif.gz_A crystal structure of bacillus subtilis ydib in complex with adp 0.8826 1 139
6n9a-assembly1.cif.gz_E-2 crystal structure of thermotoga maritima threonylcarbamoyladenosine biosynthesis complex tsab2d2e2 bound to atp and carboxy-amp 0.8814 2 138
6s84-assembly1.cif.gz_E tsabde complex from thermotoga maritima 0.8783 1 137
1fl9-assembly3.cif.gz_C the yjee protein 0.8739 1 138
ID Description Score Start End Superfamily
af_P0AF67_2_153_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9062 1 137 3.40.50.300
af_P9WFS7_20_166_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9036 1 133 3.40.50.300
af_Q2FWK9_1_139_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8876 10 136 3.40.50.300
af_K7MDC7_167_340_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8674 24 46 3.40.50.300
af_P0AF67_2_153_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8318 1 137 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1G2WHU2-F1-model_v4 deleted 0.9879 1 146
AF-A0A2W5NXL9-F1-model_v4 deleted 0.9791 1 113
AF-A0A7Y5CYK5-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9724 1 137 GO:0002949
GO:0005524
GO:0016740
AF-A0A7U6Y8P8-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9702 1 134 GO:0002949
GO:0005524
GO:0005737
AF-A0A5M6IHQ9-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9682 2 141 GO:0002949
GO:0005524
GO:0005737
GO:0016740

Map