F297214

General Info

Members Datasets Scaffolds Average Seq Length
193 175 386 308

Family's Representative Sequence

Representative Sequence 3300021320|Ga0214544_1001102|Ga0214544_100110234
Length 324
Sequence MRGPRAISGAHHELSSRGGASRFRCPTASKAPGRGLRETLAAWILAGPSVFFLLMLYCLPVIGVFVIAFTDWRFGAATLSFVGLDNFREVIADEGFRSSLRNTAIYLLIVVPSTVSLGLLIALLIEGGKSCRSFYRAIHFLPFMATMSAMAIAWEALLHPTIGLVNQTLSAIGMPAANWLRDEHTVLPALAAIGIWQNLGFAMVLFLAGLKSIPKDIYDAADVDGADLWLDRLRTVTLPMLGPVSMFVVIVVALRAFASFDTVKVLTQGGPGHASEMLLYTLYRESFEYLRTGYGAAIAVVFLAIVVTLTLVQAHLMDRKVHYQ

Samples

Sample ID Description Type Environment
1 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
21 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
22 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
23 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
24 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
25 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
26 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
27 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
30 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
31 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
32 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
33 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
34 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
35 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
36 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
37 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
38 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
39 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
40 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
41 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
42 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
43 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
44 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
45 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
46 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
47 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
48 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
49 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
50 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
51 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
52 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
53 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
54 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
55 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
56 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
57 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
58 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
59 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
60 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
61 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
62 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
63 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
64 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
65 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
66 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
67 2508501050 Microvirga lupini Lut6 Isolate Nodule
68 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
69 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
70 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
71 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
72 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
73 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
74 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
75 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
76 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
77 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
78 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
79 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
80 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
81 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
82 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
83 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
84 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
85 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
86 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
87 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
88 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
89 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
90 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
91 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
92 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
93 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
94 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
95 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
96 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
97 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
98 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
99 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
100 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
101 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
102 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
103 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
104 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
105 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
106 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
107 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
108 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
109 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
110 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
111 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
112 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
113 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
114 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
115 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
116 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
117 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
118 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
119 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
120 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
121 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
122 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
123 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
124 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
125 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
126 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
127 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
128 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
129 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
130 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
131 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
132 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
133 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
134 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
135 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
136 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
137 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
138 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
139 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
140 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
141 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
142 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
143 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
144 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
145 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
146 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
147 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
148 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
149 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
150 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
151 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
152 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
153 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
154 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
155 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
156 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
157 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
158 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
159 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
160 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
161 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
162 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
163 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
164 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
165 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
166 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
167 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
168 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
169 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
170 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
171 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
172 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
173 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
174 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
175 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 40.93
Metatranscriptomes 0
Isolates 59.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.51
Nodule 54.92
Rhizoplane 1.04
Rhizosphere 8.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0214544_1001102 3300021320 Bacteria 54570
2 JGI25159J45721_1000379 3300002987 Bacteria 20571
3 JGI25406J46586_10008624 3300003203 Bacteria 4605
4 JGI25160J50197_1000580 3300003354 Bacteria 20571
5 JGI25161J50226_1000416 3300003374 Bacteria 20571
6 Ga0055543_1000564 3300004625 Bacteria 20609
7 Ga0065165_1001852 3300005262 Bacteria 20609
8 Ga0070714_100134725 3300005435 Bacteria 2211
9 Ga0070713_100072130 3300005436 Bacteria 2920
10 Ga0070707_100046115 3300005468 Bacteria 4171
11 Ga0070698_100034815 3300005471 Bacteria 5210
12 Ga0070697_100164912 3300005536 Bacteria 1873
13 Ga0081540_1000761 3300005983 Bacteria 29679
14 Ga0081540_1045697 3300005983 Bacteria 2220
15 Ga0081539_10000455 3300005985 Bacteria 87222
16 Ga0081539_10005129 3300005985 Bacteria 13673
17 Ga0070717_10209015 3300006028 Bacteria 1712
18 Ga0075364_10003583 3300006051 Bacteria 8844
19 Ga0075367_10033373 3300006178 Bacteria 2966
20 Ga0079104_1000544 3300006946 Bacteria 39404
21 Ga0105238_10135109 3300009551 Bacteria 2444
22 Ga0214542_1001818 3300021321 Bacteria 44104
23 Ga0213876_10072205 3300021384 Bacteria 1823
24 Ga0228711_1012016 3300022739 Bacteria 10772
25 Ga0228710_1015812 3300022740 Bacteria 8115
26 Ga0228710_1022736 3300022740 Bacteria 4746
27 Ga0209130_1001066 3300025284 Bacteria 20624
28 Ga0209758_1002645 3300025297 Bacteria 17756
29 Ga0207426_1001371 3300025302 Bacteria 20624
30 Ga0209051_1004469 3300025303 Bacteria 8604
31 Ga0207664_10142234 3300025929 Bacteria 2031
32 Ga0209281_1000522 3300027111 Bacteria 49802
33 Ga0209282_1000118 3300027666 Bacteria 50974
34 Ga0315914_1000617 3300031967 Bacteria 47017
35 Ga0315914_1003482 3300031967 Bacteria 23899
36 Ga0315913_1000151 3300033430 Bacteria 47016
37 Ga0315913_1006764 3300033430 Bacteria 13842
38 Ga0315915_1000286 3300033464 Bacteria 47014
39 Ga0436364_1016440 3300037853 Bacteria 3269
40 Ga0436365_1838470 3300039437 Bacteria 3282
41 Ga0495673_0087527 3300047469 Bacteria 1278
42 Ga0496102_0003429 3300048905 Bacteria 13436
43 Ga0496106_0521255 3300048909 Bacteria 954
44 Ga0496116_0019065 3300048919 Bacteria 5266
45 Ga0496117_0000373 3300048920 Bacteria 77595
46 Ga0496117_0044024 3300048920 Bacteria 3237
47 Ga0496118_0000021 3300048921 Bacteria 444988
48 Ga0496118_0094833 3300048921 Bacteria 2039
49 Ga0496119_0011072 3300048922 Bacteria 7513
50 Ga0496119_0052737 3300048922 Bacteria 2489
51 Ga0496120_0026376 3300048923 Bacteria 3589
52 Ga0496121_0003617 3300048924 Bacteria 21814
53 Ga0496121_0011497 3300048924 Bacteria 9812
54 Ga0496122_0003710 3300048925 Bacteria 19747
55 Ga0496123_0001431 3300048926 Bacteria 33345
56 Ga0496124_0043646 3300048927 Bacteria 3853
57 Ga0496125_0002306 3300048928 Bacteria 25178
58 Ga0496126_0049945 3300048929 Bacteria 3816
59 Ga0496126_0053476 3300048929 Bacteria 3664
60 Ga0496126_0075421 3300048929 Bacteria 2993
61 Ga0496126_0158529 3300048929 Bacteria 1935
62 Ga0496126_0294308 3300048929 Bacteria 1341
63 nmdc:mga03n38_27227_c1 3300050490 Bacteria 2369
64 nmdc:mga06z11_22867_c1 3300050494 Bacteria 2927
65 nmdc:mga07m45_6053_c1 3300050496 Bacteria 6090
66 Ga0500566_0000005 3300053094 Bacteria 159299
67 Ga0500556_0000023 3300053104 Bacteria 168755
68 Ga0500572_000016 3300053111 Bacteria 51017
69 Ga0500595_001364 3300053119 Bacteria 13121
70 Ga0500614_002525 3300053123 Bacteria 4057
71 Ga0500559_0003912 3300053136 Bacteria 7192
72 Ga0500568_0028776 3300053139 Bacteria 2314
73 Ga0500603_000389 3300053150 Bacteria 11496
74 Ga0500620_049225 3300053155 Bacteria 1408
75 Ga0500622_0008451 3300053156 Bacteria 5763
76 Ga0500630_000821 3300053159 Bacteria 14313
77 Ga0500639_000023 3300053163 Bacteria 85696
78 Ga0500645_067822 3300053730 Bacteria 1026
79 Ga0500601_001629 3300053737 Bacteria 2424
80 2508726042 2508501050 Bacteria 9633614
81 2509144777 2508501127 Bacteria 7037543
82 2509150660 2508501128 Bacteria 8613869
83 2513612308 2513237090 Bacteria 7096802
84 2513620607 2513237091 Bacteria 6900273
85 2513641597 2513237094 Bacteria 8789602
86 2513698624 2513237101 Bacteria 7952346
87 2513716474 2513237104 Bacteria 10034502
88 2514000680 2513237159 Bacteria 6810126
89 2551690773 2551306086 Bacteria 6843938
90 2551712239 2551306089 Bacteria 7162724
91 2551732944 2551306092 Bacteria 6992595
92 2617354139 2617270735 Bacteria 9163226
93 2617384449 2617270742 Bacteria 6808054
94 2694631808 2693429783 Bacteria 7019804
95 2694639257 2693429784 Bacteria 7241525
96 2723844434 2721755755 Bacteria 8322773
97 2728751226 2728368998 Bacteria 8720350
98 2776267985 2775506902 Bacteria 6208009
99 2776281959 2775506904 Bacteria 5954060
100 2840765374 2840764183 Bacteria 6358399
101 2840765395 2840764183 Bacteria 6358399
102 2840767024 2840764183 Bacteria 6358399
103 2841981434 2841974524 Bacteria 8931498
104 2841986019 2841983080 Bacteria 8395090
105 2842044616 2842038055 Bacteria 8002051
106 2842051395 2842045827 Bacteria 8006841
107 2842526652 2842521101 Bacteria 6569494
108 2874616971 2874612657 Bacteria 8252029
109 2876374138 2876369609 Bacteria 6807521
110 2876809406 2876808645 Bacteria 8824342
111 2879101433 2879099564 Bacteria 10442239
112 2879115290 2879110137 Bacteria 8907982
113 2881666173 2881665667 Bacteria 8175609
114 2888380841 2888378607 Bacteria 9652610
115 2889796233 2889790730 Bacteria 5689708
116 2903752773 2903748898 Bacteria 9972761
117 2906626880 2906626472 Bacteria 8826946
118 2906630664 2906626472 Bacteria 8826946
119 2908758462 2908756301 Bacteria 8864324
120 2913298579 2913295892 Bacteria 6333755
121 2915986339 2915980308 Bacteria 6624279
122 2920762673 2920760137 Bacteria 7427611
123 2921202606 2921201388 Bacteria 6926299
124 2924157495 2924150972 Bacteria 7169444
125 2924760978 2924754689 Bacteria 6774424
126 2932789262 2932784394 Bacteria 9704911
127 2932801409 2932794094 Bacteria 7915132
128 2932806199 2932801729 Bacteria 7987968
129 2935613849 2935608549 Bacteria 8203142
130 2935638070 2935630451 Bacteria 8169952
131 2935647318 2935638405 Bacteria 10015038
132 2935656059 2935648319 Bacteria 8801166
133 2935664878 2935656913 Bacteria 8965014
134 2935711633 2935703347 Bacteria 10242284
135 2935836793 2935827899 Bacteria 10038562
136 2935873011 2935864058 Bacteria 9784707
137 2935882028 2935873716 Bacteria 9632195
138 2935916604 2935908558 Bacteria 8568796
139 2935925268 2935916978 Bacteria 9113783
140 2935934089 2935926038 Bacteria 8601059
141 2935942566 2935934488 Bacteria 8602579
142 2935951006 2935942939 Bacteria 8599779
143 2935959466 2935951376 Bacteria 8602333
144 2935965130 2935959822 Bacteria 7869783
145 2935975534 2935967501 Bacteria 8603075
146 2935991980 2935984226 Bacteria 8302647
147 2936000766 2935992306 Bacteria 9802711
148 2936018908 2936011229 Bacteria 8801034
149 2936027577 2936019824 Bacteria 8804134
150 2936036341 2936028420 Bacteria 8965941
151 2936054432 2936046547 Bacteria 8903709
152 2937063679 2937056579 Bacteria 7107896
153 2937069917 2937063883 Bacteria 7199456
154 2937098594 2937091812 Bacteria 6979387
155 2937107525 2937106411 Bacteria 6947143
156 2941514704 2941507105 Bacteria 8166816
157 2941522653 2941515067 Bacteria 8166720
158 2941530595 2941523033 Bacteria 8169134
159 2957448633 2957443900 Bacteria 6869977
160 2957462553 2957457609 Bacteria 6967680
161 2957498665 2957498199 Bacteria 7126688
162 2960590619 2960584000 Bacteria 6864594
163 2960653802 2960652885 Bacteria 7083688
164 2960665850 2960660292 Bacteria 7041660
165 2960686747 2960680706 Bacteria 6624464
166 2964614955 2964607997 Bacteria 7101408
167 2964663373 2964656573 Bacteria 7100150
168 2965067896 2965062239 Bacteria 7412989
169 2967665926 2967664464 Bacteria 6948836
170 2967754676 2967748971 Bacteria 6733771
171 2970039512 2970033650 Bacteria 7118744
172 2970072860 2970068827 Bacteria 7123112
173 2970157187 2970156795 Bacteria 7168044
174 2970185451 2970184632 Bacteria 7054431
175 2977536719 2977530762 Bacteria 6951399
176 2977989100 2977986579 Bacteria 6581278
177 3002142796 3002141150 Bacteria 5254435
178 3004342033 3004334049 Bacteria 8449246
179 3005478447 3005474847 Bacteria 9259049
180 3005717054 3005710791 Bacteria 7622528
181 8003998763 8003992118 Bacteria 7266902
182 8006973144 8006964411 Bacteria 8966052
183 8006973336 8006964411 Bacteria 8966052
184 8007001765 8006994254 Bacteria 8309700
185 8019564698 8019555841 Bacteria 9642137
186 8019574791 8019565922 Bacteria 9639779
187 8019585853 8019576017 Bacteria 10049540
188 8019593838 8019586578 Bacteria 10212056
189 8019597638 8019597564 Bacteria 10041141
190 8019610748 8019608314 Bacteria 10042931
191 8046767960 8046767195 Bacteria 7547379
192 8046771354 8046767195 Bacteria 7547379
193 8056689035 8056681323 Bacteria 8472857
194 Ga0214544_1001102
195 JGI25159J45721_1000379
196 JGI25406J46586_10008624
197 JGI25160J50197_1000580
198 JGI25161J50226_1000416
199 Ga0055543_1000564
200 Ga0065165_1001852
201 Ga0070714_100134725
202 Ga0070713_100072130
203 Ga0070707_100046115
204 Ga0070698_100034815
205 Ga0070697_100164912
206 Ga0081540_1000761
207 Ga0081540_1045697
208 Ga0081539_10000455
209 Ga0081539_10005129
210 Ga0070717_10209015
211 Ga0075364_10003583
212 Ga0075367_10033373
213 Ga0079104_1000544
214 Ga0105238_10135109
215 Ga0214542_1001818
216 Ga0213876_10072205
217 Ga0228711_1012016
218 Ga0228710_1015812
219 Ga0228710_1022736
220 Ga0209130_1001066
221 Ga0209758_1002645
222 Ga0207426_1001371
223 Ga0209051_1004469
224 Ga0207664_10142234
225 Ga0209281_1000522
226 Ga0209282_1000118
227 Ga0315914_1000617
228 Ga0315914_1003482
229 Ga0315913_1000151
230 Ga0315913_1006764
231 Ga0315915_1000286
232 Ga0436364_1016440
233 Ga0436365_1838470
234 Ga0495673_0087527
235 Ga0496102_0003429
236 Ga0496106_0521255
237 Ga0496116_0019065
238 Ga0496117_0000373
239 Ga0496117_0044024
240 Ga0496118_0000021
241 Ga0496118_0094833
242 Ga0496119_0011072
243 Ga0496119_0052737
244 Ga0496120_0026376
245 Ga0496121_0003617
246 Ga0496121_0011497
247 Ga0496122_0003710
248 Ga0496123_0001431
249 Ga0496124_0043646
250 Ga0496125_0002306
251 Ga0496126_0049945
252 Ga0496126_0053476
253 Ga0496126_0075421
254 Ga0496126_0158529
255 Ga0496126_0294308
256 nmdc:mga03n38_27227_c1
257 nmdc:mga06z11_22867_c1
258 nmdc:mga07m45_6053_c1
259 Ga0500566_0000005
260 Ga0500556_0000023
261 Ga0500572_000016
262 Ga0500595_001364
263 Ga0500614_002525
264 Ga0500559_0003912
265 Ga0500568_0028776
266 Ga0500603_000389
267 Ga0500620_049225
268 Ga0500622_0008451
269 Ga0500630_000821
270 Ga0500639_000023
271 Ga0500645_067822
272 Ga0500601_001629
273 2508726042
274 2509144777
275 2509150660
276 2513612308
277 2513620607
278 2513641597
279 2513698624
280 2513716474
281 2514000680
282 2551690773
283 2551712239
284 2551732944
285 2617354139
286 2617384449
287 2694631808
288 2694639257
289 2723844434
290 2728751226
291 2776267985
292 2776281959
293 2840765374
294 2840765395
295 2840767024
296 2841981434
297 2841986019
298 2842044616
299 2842051395
300 2842526652
301 2874616971
302 2876374138
303 2876809406
304 2879101433
305 2879115290
306 2881666173
307 2888380841
308 2889796233
309 2903752773
310 2906626880
311 2906630664
312 2908758462
313 2913298579
314 2915986339
315 2920762673
316 2921202606
317 2924157495
318 2924760978
319 2932789262
320 2932801409
321 2932806199
322 2935613849
323 2935638070
324 2935647318
325 2935656059
326 2935664878
327 2935711633
328 2935836793
329 2935873011
330 2935882028
331 2935916604
332 2935925268
333 2935934089
334 2935942566
335 2935951006
336 2935959466
337 2935965130
338 2935975534
339 2935991980
340 2936000766
341 2936018908
342 2936027577
343 2936036341
344 2936054432
345 2937063679
346 2937069917
347 2937098594
348 2937107525
349 2941514704
350 2941522653
351 2941530595
352 2957448633
353 2957462553
354 2957498665
355 2960590619
356 2960653802
357 2960665850
358 2960686747
359 2964614955
360 2964663373
361 2965067896
362 2967665926
363 2967754676
364 2970039512
365 2970072860
366 2970157187
367 2970185451
368 2977536719
369 2977989100
370 3002142796
371 3004342033
372 3005478447
373 3005717054
374 8003998763
375 8006973144
376 8006973336
377 8007001765
378 8019564698
379 8019574791
380 8019585853
381 8019593838
382 8019597638
383 8019610748
384 8046767960
385 8046771354
386 8056689035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

102

322

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8048 23 304
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7902 23 303
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.7804 23 304
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.7797 23 303
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7795 23 303
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8335 66 307 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8314 66 306 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.827 66 307 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8129 66 306 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8027 66 305 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A5R2NA87-F1-model_v4 Sugar ABC transporter permease 0.8716 23 250 GO:0005886
GO:0055085
AF-A0A521MEH4-F1-model_v4 Sugar ABC transporter permease 0.8439 39 309 GO:0005886
GO:0055085
AF-A0A1H8XWT5-F1-model_v4 Carbohydrate ABC transporter membrane protein 1, CUT1 family 0.8421 22 305 GO:0005886
GO:0055085
AF-A0A502G6W8-F1-model_v4 Sugar ABC transporter permease 0.842 37 309 GO:0005886
GO:0055085
AF-A0A323U130-F1-model_v4 Sugar ABC transporter permease 0.8401 46 301 GO:0005886
GO:0055085

Map