F297041

General Info

Members Datasets Scaffolds Average Seq Length
193 140 386 125

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100675254|Ga0075436_1006752541
Length 133
Sequence LEELETLHERYRDRVAFFVVYIKEAHPEDGWVMNDNRRADIKVQDPTSDAERAIVAEACALRLKIRMPVLLDSIDNEVARQYGGWPDRLYLIDCESRVAFQGDKGPFGFRPEDLQAAIERELANAAPHEAAQP

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
46 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
47 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
57 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
58 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
59 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
60 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
61 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
62 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
63 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
64 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
65 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
66 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
67 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
68 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
69 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
70 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
71 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
72 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
73 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
74 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
75 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
83 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
84 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
85 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
86 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
135 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.63
Rhizosphere 96.37
Stem 0
Stem Tuber 0
Unclassified 11.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100675254 3300006914 Unclassified 764
2 Ga0070683_100683458 3300005329 Bacteria 983
3 Ga0070661_100282189 3300005344 Bacteria 1289
4 Ga0070674_100014535 3300005356 Bacteria 4895
5 Ga0070701_10242926 3300005438 Bacteria 1084
6 Ga0070700_100297961 3300005441 Bacteria 1176
7 Ga0070708_100029252 3300005445 Bacteria 4749
8 Ga0070708_100222311 3300005445 Unclassified 1771
9 Ga0070708_100323853 3300005445 Unclassified 1452
10 Ga0070708_100455542 3300005445 Bacteria 1207
11 Ga0070708_100772497 3300005445 Unclassified 903
12 Ga0070708_101012381 3300005445 Bacteria 779
13 Ga0068867_101032514 3300005459 Bacteria 747
14 Ga0070706_100070324 3300005467 Bacteria 3237
15 Ga0070706_100109868 3300005467 Bacteria 2565
16 Ga0070707_100135657 3300005468 Bacteria 2394
17 Ga0070707_100610679 3300005468 Bacteria 1053
18 Ga0070707_100723885 3300005468 Bacteria 958
19 Ga0070698_101027957 3300005471 Bacteria 771
20 Ga0070699_100084458 3300005518 Bacteria 2771
21 Ga0070699_100181911 3300005518 Bacteria 1865
22 Ga0070699_100580328 3300005518 Bacteria 1022
23 Ga0070699_100639632 3300005518 Bacteria 971
24 Ga0070684_100606536 3300005535 Bacteria 1018
25 Ga0070697_101024835 3300005536 Unclassified 734
26 Ga0070697_101789353 3300005536 Bacteria 550
27 Ga0070672_100278696 3300005543 Bacteria 1413
28 Ga0070695_100075931 3300005545 Bacteria 2212
29 Ga0070665_100060622 3300005548 Bacteria 3793
30 Ga0068862_101591671 3300005844 Bacteria 660
31 Ga0070716_101086911 3300006173 Bacteria 637
32 Ga0075433_10000044 3300006852 Bacteria 51321
33 Ga0075434_100000739 3300006871 Bacteria 25699
34 Ga0068865_100541828 3300006881 Bacteria 976
35 Ga0075436_100006335 3300006914 Bacteria 8110
36 Ga0075435_100005648 3300007076 Archaea 8766
37 Ga0099794_10029479 3300007265 Unclassified 2557
38 Ga0111539_10568404 3300009094 Bacteria 1320
39 Ga0105245_11601461 3300009098 Bacteria 703
40 Ga0114129_12467094 3300009147 Bacteria 622
41 Ga0105242_11078781 3300009176 Bacteria 816
42 Ga0207684_10010372 3300025910 Bacteria 8201
43 Ga0207646_10107745 3300025922 Bacteria 2500
44 Ga0207646_10576702 3300025922 Bacteria 1011
45 Ga0207659_10094318 3300025926 Bacteria 2242
46 Ga0207687_10844642 3300025927 Bacteria 782
47 Ga0207690_10487366 3300025932 Bacteria 996
48 Ga0207686_10595815 3300025934 Bacteria 869
49 Ga0207669_10042083 3300025937 Bacteria 2664
50 Ga0207704_10226365 3300025938 Unclassified 1387
51 Ga0207691_10178080 3300025940 Bacteria 1859
52 Ga0207689_10734157 3300025942 Bacteria 833
53 Ga0207677_10370385 3300026023 Bacteria 1206
54 Ga0207678_11266235 3300026067 Bacteria 653
55 Ga0207708_10034769 3300026075 Bacteria 3834
56 Ga0207648_10179634 3300026089 Bacteria 1873
57 Ga0207648_10196799 3300026089 Bacteria 1787
58 Ga0207428_10891586 3300027907 Bacteria 629
59 Ga0268266_10585327 3300028379 Unclassified 1071
60 Ga0307405_10084578 3300031731 Bacteria 2083
61 Ga0307405_11758589 3300031731 Bacteria 550
62 Ga0307406_10870432 3300031901 Bacteria 765
63 Ga0307407_10703306 3300031903 Bacteria 761
64 Ga0307409_100047546 3300031995 Bacteria 3258
65 Ga0307409_100378895 3300031995 Bacteria 1344
66 Ga0307409_100490809 3300031995 Bacteria 1194
67 Ga0307409_101357737 3300031995 Bacteria 736
68 Ga0307409_101782236 3300031995 Bacteria 645
69 Ga0307416_100142407 3300032002 Bacteria 2182
70 Ga0307416_100498981 3300032002 Bacteria 1281
71 Ga0307416_101567009 3300032002 Bacteria 764
72 Ga0307415_100008293 3300032126 Bacteria 5752
73 Ga0307415_101182301 3300032126 Bacteria 720
74 Ga0307415_102274825 3300032126 Bacteria 531
75 Ga0307415_102353660 3300032126 Bacteria 523
76 Ga0373925_0481331 3300037068 Bacteria 1018
77 Ga0395900_0006046 3300037418 Bacteria 12624
78 Ga0395898_0014965 3300037466 Bacteria 7966
79 Ga0395905_0605632 3300037471 Bacteria 997
80 Ga0395901_0013873 3300038443 Bacteria 8197
81 Ga0439438_015923 3300041405 Bacteria 2198
82 Ga0439453_0035105 3300041408 Bacteria 965
83 Ga0439461_0002333 3300041410 Bacteria 3018
84 Ga0439461_0028603 3300041410 Bacteria 1149
85 Ga0439466_0069375 3300041411 Bacteria 1125
86 Ga0439465_0048651 3300041413 Bacteria 1384
87 Ga0439431_0038366 3300041997 Bacteria 1212
88 Ga0439433_0003631 3300041999 Bacteria 3319
89 Ga0439441_017295 3300042001 Bacteria 1293
90 Ga0439442_070299 3300042002 Bacteria 745
91 Ga0439442_113908 3300042002 Bacteria 590
92 Ga0439449_0041237 3300042007 Bacteria 1716
93 Ga0439462_0004520 3300042015 Bacteria 3401
94 Ga0450913_012659 3300042117 Bacteria 700
95 Ga0450920_055715 3300042122 Bacteria 796
96 Ga0450923_155534 3300042125 Bacteria 555
97 Ga0450907_020623 3300042146 Bacteria 1107
98 Ga0450910_045908 3300042147 Bacteria 714
99 Ga0439446_0002837 3300042156 Bacteria 4215
100 Ga0439446_0002889 3300042156 Bacteria 4190
101 Ga0439458_0118391 3300042157 Bacteria 696
102 Ga0439434_0005302 3300042435 Bacteria 3771
103 Ga0439434_0038807 3300042435 Bacteria 1460
104 Ga0466969_0470119 3300044656 Unclassified 573
105 Ga0466966_0069408 3300044684 Bacteria 2211
106 Ga0466963_0889712 3300044694 Unclassified 628
107 Ga0466968_0120644 3300044735 Unclassified 1186
108 Ga0466958_0020613 3300045836 Bacteria 3847
109 Ga0466967_0259998 3300045976 Bacteria 1661
110 Ga0466967_0449276 3300045976 Bacteria 1259
111 Ga0495651_0196839 3300046462 Bacteria 1414
112 Ga0495584_0119634 3300046491 Bacteria 1334
113 Ga0495585_0368345 3300046492 Bacteria 696
114 Ga0495596_0422894 3300046500 Unclassified 519
115 Ga0495607_0541738 3300046501 Unclassified 512
116 Ga0495656_0571602 3300046615 Bacteria 604
117 Ga0495668_0499254 3300046616 Bacteria 671
118 Ga0495657_0122094 3300046675 Bacteria 1640
119 Ga0495613_0986596 3300046689 Unclassified 542
120 Ga0495624_0847941 3300046690 Bacteria 539
121 Ga0495604_0136286 3300047317 Bacteria 1759
122 Ga0495602_0672524 3300048088 Unclassified 705
123 Ga0496101_0869638 3300048904 Unclassified 710
124 Ga0496102_0211835 3300048905 Bacteria 1827
125 Ga0496109_0170728 3300048912 Bacteria 2040
126 Ga0496109_1871135 3300048912 Unclassified 533
127 Ga0496110_1202781 3300048913 Bacteria 667
128 Ga0496111_0526396 3300048914 Unclassified 869
129 Ga0496113_0713679 3300048916 Unclassified 800
130 Ga0501031_0003281 3300049568 Bacteria 10392
131 Ga0501031_0067621 3300049568 Bacteria 2327
132 Ga0501032_0020843 3300049569 Bacteria 4561
133 Ga0501033_0041138 3300049570 Bacteria 3450
134 Ga0501034_1000289 3300049571 Bacteria 720
135 Ga0501036_0004126 3300049572 Bacteria 11685
136 Ga0501036_0018774 3300049572 Bacteria 5799
137 Ga0501037_0016169 3300049573 Bacteria 5492
138 Ga0501037_0093200 3300049573 Bacteria 2178
139 Ga0501038_0017113 3300049574 Bacteria 6557
140 Ga0501038_0030542 3300049574 Bacteria 4767
141 Ga0501039_0001806 3300049575 Bacteria 15825
142 Ga0501040_0078552 3300049576 Bacteria 2283
143 Ga0501041_0002965 3300049577 Bacteria 9731
144 Ga0501041_0006801 3300049577 Bacteria 6701
145 Ga0501041_0300796 3300049577 Bacteria 1011
146 Ga0501042_0001545 3300049578 Bacteria 13628
147 Ga0501043_0210220 3300049579 Bacteria 1508
148 Ga0501046_0003654 3300049580 Bacteria 14084
149 Ga0501048_0001503 3300049582 Bacteria 17647
150 Ga0501048_0029253 3300049582 Bacteria 3997
151 Ga0501068_0013730 3300049584 Bacteria 4614
152 Ga0501068_0215401 3300049584 Bacteria 1220
153 Ga0501070_0186789 3300049586 Bacteria 1705
154 Ga0501071_0001415 3300049587 Bacteria 13806
155 Ga0501071_0171282 3300049587 Bacteria 1625
156 Ga0501072_0009597 3300049588 Bacteria 7358
157 Ga0501072_0185659 3300049588 Bacteria 1659
158 Ga0501073_0791664 3300049589 Bacteria 654
159 Ga0501074_0050377 3300049590 Bacteria 3006
160 Ga0501074_0420891 3300049590 Bacteria 947
161 Ga0501075_0003197 3300049591 Bacteria 10961
162 Ga0501076_0004491 3300049592 Bacteria 9938
163 Ga0501076_0008267 3300049592 Bacteria 7623
164 Ga0501077_0000985 3300049593 Bacteria 17153
165 Ga0501079_0003145 3300049741 Bacteria 12101
166 Ga0501079_0010798 3300049741 Bacteria 6955
167 Ga0501080_0308439 3300049742 Bacteria 1434
168 Ga0501081_0002309 3300049743 Bacteria 12012
169 Ga0501081_0009349 3300049743 Bacteria 6386
170 Ga0501035_0126675 3300049822 Bacteria 2229
171 Ga0501044_0479648 3300049823 Bacteria 1147
172 Ga0501045_0002277 3300049824 Bacteria 13003
173 Ga0501045_0005780 3300049824 Bacteria 8559
174 nmdc:mga0qj67_727975_c1 3300050509 Unclassified 788
175 nmdc:mga08y16_1145588_c1 3300050511 Bacteria 751
176 nmdc:mga0n895_119_c1 3300050512 Bacteria 46790
177 nmdc:mga0rr50_871_c1 3300050513 Bacteria 16299
178 nmdc:mga08x19_6299_c1 3300050514 Archaea 7025
179 nmdc:mga0a205_2625_c1 3300050515 Bacteria 15880
180 Ga0495612_0118167 3300053078 Bacteria 1139
181 Ga0495595_0283591 3300053084 Unclassified 832
182 Ga0495619_0064806 3300053085 Bacteria 2437
183 Ga0501084_0009527 3300054114 Bacteria 8037
184 Ga0501084_0011433 3300054114 Bacteria 7349
185 Ga0501082_0004646 3300060353 Bacteria 11979
186 Ga0501082_0010213 3300060353 Bacteria 8082
187 Ga0501082_0858736 3300060353 Unclassified 794
188 Ga0466962_0609451 3300061719 Bacteria 557
189 Ga0530510_0005836 3300061734 Bacteria 8532
190 Ga0530510_0147989 3300061734 Bacteria 1733
191 Ga0530510_0328807 3300061734 Bacteria 1146
192 Ga0530510_0683287 3300061734 Bacteria 782
193 Ga0530510_0745739 3300061734 Unclassified 747
194 Ga0075436_100675254
195 Ga0070683_100683458
196 Ga0070661_100282189
197 Ga0070674_100014535
198 Ga0070701_10242926
199 Ga0070700_100297961
200 Ga0070708_100029252
201 Ga0070708_100222311
202 Ga0070708_100323853
203 Ga0070708_100455542
204 Ga0070708_100772497
205 Ga0070708_101012381
206 Ga0068867_101032514
207 Ga0070706_100070324
208 Ga0070706_100109868
209 Ga0070707_100135657
210 Ga0070707_100610679
211 Ga0070707_100723885
212 Ga0070698_101027957
213 Ga0070699_100084458
214 Ga0070699_100181911
215 Ga0070699_100580328
216 Ga0070699_100639632
217 Ga0070684_100606536
218 Ga0070697_101024835
219 Ga0070697_101789353
220 Ga0070672_100278696
221 Ga0070695_100075931
222 Ga0070665_100060622
223 Ga0068862_101591671
224 Ga0070716_101086911
225 Ga0075433_10000044
226 Ga0075434_100000739
227 Ga0068865_100541828
228 Ga0075436_100006335
229 Ga0075435_100005648
230 Ga0099794_10029479
231 Ga0111539_10568404
232 Ga0105245_11601461
233 Ga0114129_12467094
234 Ga0105242_11078781
235 Ga0207684_10010372
236 Ga0207646_10107745
237 Ga0207646_10576702
238 Ga0207659_10094318
239 Ga0207687_10844642
240 Ga0207690_10487366
241 Ga0207686_10595815
242 Ga0207669_10042083
243 Ga0207704_10226365
244 Ga0207691_10178080
245 Ga0207689_10734157
246 Ga0207677_10370385
247 Ga0207678_11266235
248 Ga0207708_10034769
249 Ga0207648_10179634
250 Ga0207648_10196799
251 Ga0207428_10891586
252 Ga0268266_10585327
253 Ga0307405_10084578
254 Ga0307405_11758589
255 Ga0307406_10870432
256 Ga0307407_10703306
257 Ga0307409_100047546
258 Ga0307409_100378895
259 Ga0307409_100490809
260 Ga0307409_101357737
261 Ga0307409_101782236
262 Ga0307416_100142407
263 Ga0307416_100498981
264 Ga0307416_101567009
265 Ga0307415_100008293
266 Ga0307415_101182301
267 Ga0307415_102274825
268 Ga0307415_102353660
269 Ga0373925_0481331
270 Ga0395900_0006046
271 Ga0395898_0014965
272 Ga0395905_0605632
273 Ga0395901_0013873
274 Ga0439438_015923
275 Ga0439453_0035105
276 Ga0439461_0002333
277 Ga0439461_0028603
278 Ga0439466_0069375
279 Ga0439465_0048651
280 Ga0439431_0038366
281 Ga0439433_0003631
282 Ga0439441_017295
283 Ga0439442_070299
284 Ga0439442_113908
285 Ga0439449_0041237
286 Ga0439462_0004520
287 Ga0450913_012659
288 Ga0450920_055715
289 Ga0450923_155534
290 Ga0450907_020623
291 Ga0450910_045908
292 Ga0439446_0002837
293 Ga0439446_0002889
294 Ga0439458_0118391
295 Ga0439434_0005302
296 Ga0439434_0038807
297 Ga0466969_0470119
298 Ga0466966_0069408
299 Ga0466963_0889712
300 Ga0466968_0120644
301 Ga0466958_0020613
302 Ga0466967_0259998
303 Ga0466967_0449276
304 Ga0495651_0196839
305 Ga0495584_0119634
306 Ga0495585_0368345
307 Ga0495596_0422894
308 Ga0495607_0541738
309 Ga0495656_0571602
310 Ga0495668_0499254
311 Ga0495657_0122094
312 Ga0495613_0986596
313 Ga0495624_0847941
314 Ga0495604_0136286
315 Ga0495602_0672524
316 Ga0496101_0869638
317 Ga0496102_0211835
318 Ga0496109_0170728
319 Ga0496109_1871135
320 Ga0496110_1202781
321 Ga0496111_0526396
322 Ga0496113_0713679
323 Ga0501031_0003281
324 Ga0501031_0067621
325 Ga0501032_0020843
326 Ga0501033_0041138
327 Ga0501034_1000289
328 Ga0501036_0004126
329 Ga0501036_0018774
330 Ga0501037_0016169
331 Ga0501037_0093200
332 Ga0501038_0017113
333 Ga0501038_0030542
334 Ga0501039_0001806
335 Ga0501040_0078552
336 Ga0501041_0002965
337 Ga0501041_0006801
338 Ga0501041_0300796
339 Ga0501042_0001545
340 Ga0501043_0210220
341 Ga0501046_0003654
342 Ga0501048_0001503
343 Ga0501048_0029253
344 Ga0501068_0013730
345 Ga0501068_0215401
346 Ga0501070_0186789
347 Ga0501071_0001415
348 Ga0501071_0171282
349 Ga0501072_0009597
350 Ga0501072_0185659
351 Ga0501073_0791664
352 Ga0501074_0050377
353 Ga0501074_0420891
354 Ga0501075_0003197
355 Ga0501076_0004491
356 Ga0501076_0008267
357 Ga0501077_0000985
358 Ga0501079_0003145
359 Ga0501079_0010798
360 Ga0501080_0308439
361 Ga0501081_0002309
362 Ga0501081_0009349
363 Ga0501035_0126675
364 Ga0501044_0479648
365 Ga0501045_0002277
366 Ga0501045_0005780
367 nmdc:mga0qj67_727975_c1
368 nmdc:mga08y16_1145588_c1
369 nmdc:mga0n895_119_c1
370 nmdc:mga0rr50_871_c1
371 nmdc:mga08x19_6299_c1
372 nmdc:mga0a205_2625_c1
373 Ga0495612_0118167
374 Ga0495595_0283591
375 Ga0495619_0064806
376 Ga0501084_0009527
377 Ga0501084_0011433
378 Ga0501082_0004646
379 Ga0501082_0010213
380 Ga0501082_0858736
381 Ga0466962_0609451
382 Ga0530510_0005836
383 Ga0530510_0147989
384 Ga0530510_0328807
385 Ga0530510_0683287
386 Ga0530510_0745739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00837

T4_deiodinase

Iodothyronine deiodinase

1

122

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.7746 3 121
3gl3-assembly1.cif.gz_A crystal structure of a putative thiol:disulfide interchange protein dsbe from chlorobium tepidum 0.7551 2 123
2l5o-assembly1.cif.gz_A solution structure of a putative thioredoxin from neisseria meningitidis 0.7473 2 122
4nmu-assembly2.cif.gz_B crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor' 0.7425 3 123
2h1b-assembly2.cif.gz_B resa e80q 0.7331 3 121
ID Description Score Start End Superfamily
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7576 3 121 3.40.30.10
2l5oA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7473 2 122 3.40.30.10
af_E9QGM3_60_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7375 4 123 3.40.30.10
af_E9QGM3_60_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.717 4 123 3.40.30.10
af_Q9W5T4_48_199_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7168 2 122 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A5B9PIS9-F1-model_v4 Iodothyronine deiodinase 0.8506 8 122 GO:0004800
GO:0005509
GO:0042403
AF-A0A3M1T4S2-F1-model_v4 Deiodinase 0.8494 1 123 GO:0004800
AF-A0A1F6CAK4-F1-model_v4 Deiodinase 0.8492 44 122 GO:0004800
AF-A0A7W1GLU2-F1-model_v4 Deiodinase 0.8478 58 122 GO:0004800
AF-A0A3M1TPA0-F1-model_v4 Thioredoxin domain-containing protein 0.8469 1 122 GO:0004800

Map