F296978

General Info

Members Datasets Scaffolds Average Seq Length
193 106 386 220

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10105760|Ga0075368_101057602
Length 243
Sequence MTDGWFILGVDLDGVCADHTEAFRRVVAEERGVDPASLPEQTSWNFYEWGLDDATFLDLHRRAVLEHRMFRTMPVMEGAAEALWRLSDAGVWIRIVTHRLYANWGHATAVGDTVEWLDNAGIPYRDLCFLGQKPQVDAQVYIDDAPHNVAALRAEGNAVIVFDQPYNREVDGPRAESWAQVEELVLGLLQDRGVAVQEQLRGLDDARQRIAAAKRRDPAYAQSDPEMGRMAHSELKGDTPASD

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
5 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
9 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
12 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
19 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
20 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
21 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
22 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
28 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
29 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
30 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
31 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
32 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
33 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
34 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
35 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
36 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
37 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
38 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
39 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
40 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
41 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
42 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
43 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
44 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
45 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
46 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
47 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
48 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
49 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
50 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
51 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
52 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
53 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
54 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
55 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
56 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
57 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
58 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
59 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
60 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
61 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
62 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
63 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
64 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
65 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
66 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
79 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
80 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
83 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
84 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
85 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
89 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
92 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
95 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
96 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
103 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
104 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
105 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
106 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.25
Nodule 0
Rhizoplane 0.52
Rhizosphere 89.12
Stem 0
Stem Tuber 0
Unclassified 7.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10105760 3300006042 Bacteria 1158
2 JGI25407J50210_10032571 3300003373 Bacteria 1348
3 Ga0070668_100504443 3300005347 Unclassified 1048
4 Ga0070685_10427877 3300005466 Unclassified 923
5 Ga0081455_10000845 3300005937 Bacteria 39490
6 Ga0081455_10001876 3300005937 Bacteria 25294
7 Ga0081455_10055171 3300005937 Bacteria 3381
8 Ga0081538_10000109 3300005981 Bacteria 82103
9 Ga0081538_10001457 3300005981 Bacteria 24321
10 Ga0075365_10031074 3300006038 Bacteria 3424
11 Ga0075365_10151724 3300006038 Bacteria 1612
12 Ga0075365_10227443 3300006038 Bacteria 1309
13 Ga0075365_10576252 3300006038 Unclassified 796
14 Ga0075364_10010086 3300006051 Bacteria 5695
15 Ga0075364_10172297 3300006051 Bacteria 1463
16 Ga0075362_10064489 3300006177 Bacteria 1662
17 Ga0075367_10319092 3300006178 Bacteria 979
18 Ga0075428_100002595 3300006844 Bacteria 19644
19 Ga0075428_100024393 3300006844 Bacteria 6692
20 Ga0075428_100197869 3300006844 Bacteria 2173
21 Ga0075430_100007839 3300006846 Bacteria 9025
22 Ga0075430_100040769 3300006846 Bacteria 3930
23 Ga0075430_100171740 3300006846 Unclassified 1804
24 Ga0075431_100001706 3300006847 Bacteria 20646
25 Ga0075431_100013052 3300006847 Bacteria 8391
26 Ga0075431_100027928 3300006847 Bacteria 5791
27 Ga0075431_100056608 3300006847 Bacteria 4043
28 Ga0075431_100914716 3300006847 Bacteria 846
29 Ga0075429_100000562 3300006880 Bacteria 28438
30 Ga0075429_100034610 3300006880 Bacteria 4390
31 Ga0075429_100061646 3300006880 Bacteria 3268
32 Ga0075429_100068117 3300006880 Bacteria 3098
33 Ga0111539_10002282 3300009094 Bacteria 25534
34 Ga0111539_10023831 3300009094 Bacteria 7521
35 Ga0105245_10052984 3300009098 Bacteria 3641
36 Ga0114129_10004611 3300009147 Bacteria 19456
37 Ga0114129_10022880 3300009147 Bacteria 8864
38 Ga0114129_10128160 3300009147 Bacteria 3488
39 Ga0114129_10314319 3300009147 Bacteria 2084
40 Ga0114129_11627876 3300009147 Bacteria 790
41 Ga0105241_10043956 3300009174 Bacteria 3384
42 Ga0157378_10207881 3300013297 Bacteria 1854
43 Ga0157376_11415919 3300014969 Unclassified 727
44 Ga0213876_10009285 3300021384 Bacteria 5298
45 Ga0207654_10088440 3300025911 Unclassified 1882
46 Ga0207650_10111695 3300025925 Unclassified 2117
47 Ga0207687_10076462 3300025927 Unclassified 2405
48 Ga0207644_10481959 3300025931 Bacteria 1022
49 Ga0207683_10237789 3300026121 Bacteria 1661
50 Ga0207428_10026725 3300027907 Bacteria 4812
51 Ga0265334_10160888 3300028573 Bacteria 789
52 Ga0265338_10197621 3300028800 Bacteria 1519
53 Ga0265327_10134397 3300031251 Bacteria 1161
54 Ga0316576_10045752 3300031727 Bacteria 3166
55 Ga0316576_10129999 3300031727 Bacteria 1894
56 Ga0316576_10311775 3300031727 Bacteria 1175
57 Ga0316578_10050293 3300031728 Bacteria 2438
58 Ga0316577_10056053 3300031733 Bacteria 2199
59 Ga0307413_10020415 3300031824 Bacteria 3523
60 Ga0307410_10065525 3300031852 Bacteria 2499
61 Ga0307407_10070724 3300031903 Bacteria 2075
62 Ga0307409_100013221 3300031995 Bacteria 5300
63 Ga0307415_100009608 3300032126 Bacteria 5435
64 Ga0307415_100470578 3300032126 Bacteria 1091
65 Ga0316585_10041066 3300032137 Bacteria 1474
66 Ga0316574_0152158 3300035398 Bacteria 1491
67 Ga0316574_0259014 3300035398 Bacteria 1111
68 Ga0373947_0180314 3300035725 Bacteria 1375
69 Ga0316584_0003967 3300036712 Bacteria 9733
70 Ga0316584_0562986 3300036712 Bacteria 794
71 Ga0400485_15479 3300038735 Bacteria 4958
72 Ga0400483_048213 3300039062 Bacteria 49637
73 Ga0400483_164594 3300039062 Bacteria 1638
74 Ga0400483_200780 3300039062 Bacteria 45688
75 Ga0436365_0132747 3300039437 Bacteria 32462
76 Ga0439448_0040606 3300042005 Bacteria 1503
77 Ga0439463_005333 3300042016 Bacteria 3192
78 Ga0439434_0008388 3300042435 Bacteria 3029
79 Ga0439440_0001042 3300042993 Bacteria 4921
80 Ga0495639_0029497 3300046475 Bacteria 2435
81 Ga0495608_0062006 3300046511 Bacteria 2458
82 Ga0495618_0015979 3300046514 Bacteria 4585
83 Ga0495630_0018898 3300046517 Bacteria 5066
84 Ga0495630_0289482 3300046517 Bacteria 1252
85 Ga0495666_0347618 3300046526 Bacteria 668
86 Ga0495586_0109269 3300046535 Bacteria 1538
87 Ga0495621_0188261 3300046539 Bacteria 826
88 Ga0495667_0406841 3300046559 Bacteria 857
89 Ga0495635_0570267 3300046663 Bacteria 741
90 Ga0495588_0051648 3300046674 Unclassified 2118
91 Ga0495647_0082699 3300046681 Bacteria 1304
92 Ga0495658_0083498 3300046683 Bacteria 1879
93 Ga0495613_0003070 3300046689 Bacteria 12466
94 Ga0495676_0233412 3300047321 Bacteria 1263
95 Ga0495614_0034733 3300048089 Bacteria 2167
96 Ga0495614_0059022 3300048089 Bacteria 1648
97 Ga0496110_0415196 3300048913 Unclassified 1227
98 Ga0501031_0198697 3300049568 Bacteria 1309
99 Ga0501034_0000559 3300049571 Bacteria 58910
100 Ga0501034_0065553 3300049571 Bacteria 3645
101 Ga0501036_0006922 3300049572 Bacteria 9218
102 Ga0501036_0262600 3300049572 Bacteria 1446
103 Ga0501037_0200182 3300049573 Bacteria 1412
104 Ga0501038_0032969 3300049574 Bacteria 4563
105 Ga0501038_0037707 3300049574 Bacteria 4237
106 Ga0501039_0002718 3300049575 Bacteria 13194
107 Ga0501039_0063340 3300049575 Bacteria 2865
108 Ga0501039_0222193 3300049575 Bacteria 1485
109 Ga0501040_0002330 3300049576 Bacteria 12206
110 Ga0501040_0005389 3300049576 Bacteria 8276
111 Ga0501041_0001182 3300049577 Bacteria 14214
112 Ga0501041_0001204 3300049577 Bacteria 14152
113 Ga0501042_0029395 3300049578 Bacteria 3875
114 Ga0501042_0139528 3300049578 Bacteria 1747
115 Ga0501046_0003584 3300049580 Bacteria 14222
116 Ga0501047_0172668 3300049581 Bacteria 2030
117 Ga0501048_0003122 3300049582 Bacteria 12647
118 Ga0501048_0031832 3300049582 Bacteria 3814
119 Ga0501067_0068402 3300049583 Bacteria 1966
120 Ga0501067_0244118 3300049583 Archaea 999
121 Ga0501068_0000033 3300049584 Bacteria 51001
122 Ga0501068_0006578 3300049584 Bacteria 6411
123 Ga0501069_0045286 3300049585 Bacteria 2437
124 Ga0501070_0001932 3300049586 Bacteria 18295
125 Ga0501070_0064534 3300049586 Bacteria 3032
126 Ga0501071_0004691 3300049587 Bacteria 8685
127 Ga0501071_0006204 3300049587 Bacteria 7752
128 Ga0501071_0185730 3300049587 Bacteria 1558
129 Ga0501072_0003914 3300049588 Bacteria 11268
130 Ga0501072_0004689 3300049588 Bacteria 10414
131 Ga0501072_0010756 3300049588 Bacteria 6972
132 Ga0501072_0091447 3300049588 Bacteria 2416
133 Ga0501072_0536131 3300049588 Bacteria 925
134 Ga0501073_0002509 3300049589 Bacteria 13717
135 Ga0501073_0008764 3300049589 Bacteria 7486
136 Ga0501074_0008917 3300049590 Bacteria 7272
137 Ga0501074_0009412 3300049590 Bacteria 7102
138 Ga0501074_0041325 3300049590 Bacteria 3339
139 Ga0501074_0098490 3300049590 Unclassified 2093
140 Ga0501075_0004979 3300049591 Bacteria 9060
141 Ga0501076_0060948 3300049592 Bacteria 3003
142 Ga0501076_0078032 3300049592 Bacteria 2657
143 Ga0501076_0095754 3300049592 Bacteria 2391
144 Ga0501076_0864394 3300049592 Bacteria 746
145 Ga0501077_0000583 3300049593 Bacteria 22105
146 Ga0501077_0000921 3300049593 Bacteria 17682
147 Ga0501077_0060534 3300049593 Bacteria 2403
148 Ga0501079_0022036 3300049741 Bacteria 4881
149 Ga0501080_0006455 3300049742 Bacteria 10533
150 Ga0501080_0064414 3300049742 Bacteria 3409
151 Ga0501080_0084365 3300049742 Bacteria 2952
152 Ga0501080_0214018 3300049742 Bacteria 1766
153 Ga0501081_0104837 3300049743 Bacteria 2002
154 Ga0501081_0226185 3300049743 Bacteria 1362
155 Ga0501083_0001744 3300049744 Bacteria 14821
156 Ga0501083_0028995 3300049744 Bacteria 3811
157 Ga0501035_0332673 3300049822 Bacteria 1274
158 Ga0501045_0000185 3300049824 Bacteria 34755
159 Ga0501045_0003101 3300049824 Bacteria 11365
160 nmdc:mga03n38_290341_c1 3300050490 Unclassified 875
161 nmdc:mga03n38_443273_c1 3300050490 Bacteria 721
162 nmdc:mga00v17_224755_c1 3300050491 Bacteria 1216
163 nmdc:mga00v17_291685_c1 3300050491 Unclassified 1059
164 nmdc:mga00v17_323729_c1 3300050491 Bacteria 1002
165 nmdc:mga05p37_3357_c1 3300050507 Bacteria 18673
166 nmdc:mga05p37_784774_c1 3300050507 Bacteria 1045
167 nmdc:mga09592_2879_c1 3300050508 Bacteria 13951
168 nmdc:mga09592_62376_c1 3300050508 Bacteria 3154
169 nmdc:mga09592_63882_c1 3300050508 Bacteria 3116
170 nmdc:mga0qj67_1777_c1 3300050509 Bacteria 15252
171 nmdc:mga0qj67_484246_c1 3300050509 Unclassified 995
172 nmdc:mga0qj67_5813_c1 3300050509 Bacteria 9027
173 nmdc:mga0qj67_71282_c1 3300050509 Bacteria 2773
174 nmdc:mga06r32_121208_c1 3300050510 Bacteria 2580
175 nmdc:mga06r32_14406_c1 3300050510 Bacteria 7177
176 nmdc:mga06r32_234592_c1 3300050510 Bacteria 1823
177 nmdc:mga06r32_394969_c1 3300050510 Bacteria 1365
178 nmdc:mga06r32_5334_c1 3300050510 Bacteria 11575
179 nmdc:mga06r32_72483_c1 3300050510 Bacteria 3335
180 nmdc:mga08y16_10415_c1 3300050511 Bacteria 9752
181 nmdc:mga08y16_250088_c1 3300050511 Bacteria 1832
182 nmdc:mga08y16_90491_c1 3300050511 Bacteria 3190
183 Ga0495619_0126990 3300053085 Bacteria 1751
184 Ga0501084_0000517 3300054114 Bacteria 29536
185 Ga0501084_0009155 3300054114 Bacteria 8191
186 Ga0501084_0032966 3300054114 Bacteria 4333
187 Ga0501084_0274029 3300054114 Bacteria 1425
188 Ga0590074_020870 3300059423 Bacteria 1128
189 Ga0501082_0009631 3300060353 Bacteria 8317
190 Ga0501082_0340024 3300060353 Bacteria 1308
191 Ga0530510_0014889 3300061734 Bacteria 5492
192 Ga0530510_0028322 3300061734 Bacteria 4016
193 Ga0530510_0072446 3300061734 Bacteria 2500
194 Ga0075368_10105760
195 JGI25407J50210_10032571
196 Ga0070668_100504443
197 Ga0070685_10427877
198 Ga0081455_10000845
199 Ga0081455_10001876
200 Ga0081455_10055171
201 Ga0081538_10000109
202 Ga0081538_10001457
203 Ga0075365_10031074
204 Ga0075365_10151724
205 Ga0075365_10227443
206 Ga0075365_10576252
207 Ga0075364_10010086
208 Ga0075364_10172297
209 Ga0075362_10064489
210 Ga0075367_10319092
211 Ga0075428_100002595
212 Ga0075428_100024393
213 Ga0075428_100197869
214 Ga0075430_100007839
215 Ga0075430_100040769
216 Ga0075430_100171740
217 Ga0075431_100001706
218 Ga0075431_100013052
219 Ga0075431_100027928
220 Ga0075431_100056608
221 Ga0075431_100914716
222 Ga0075429_100000562
223 Ga0075429_100034610
224 Ga0075429_100061646
225 Ga0075429_100068117
226 Ga0111539_10002282
227 Ga0111539_10023831
228 Ga0105245_10052984
229 Ga0114129_10004611
230 Ga0114129_10022880
231 Ga0114129_10128160
232 Ga0114129_10314319
233 Ga0114129_11627876
234 Ga0105241_10043956
235 Ga0157378_10207881
236 Ga0157376_11415919
237 Ga0213876_10009285
238 Ga0207654_10088440
239 Ga0207650_10111695
240 Ga0207687_10076462
241 Ga0207644_10481959
242 Ga0207683_10237789
243 Ga0207428_10026725
244 Ga0265334_10160888
245 Ga0265338_10197621
246 Ga0265327_10134397
247 Ga0316576_10045752
248 Ga0316576_10129999
249 Ga0316576_10311775
250 Ga0316578_10050293
251 Ga0316577_10056053
252 Ga0307413_10020415
253 Ga0307410_10065525
254 Ga0307407_10070724
255 Ga0307409_100013221
256 Ga0307415_100009608
257 Ga0307415_100470578
258 Ga0316585_10041066
259 Ga0316574_0152158
260 Ga0316574_0259014
261 Ga0373947_0180314
262 Ga0316584_0003967
263 Ga0316584_0562986
264 Ga0400485_15479
265 Ga0400483_048213
266 Ga0400483_164594
267 Ga0400483_200780
268 Ga0436365_0132747
269 Ga0439448_0040606
270 Ga0439463_005333
271 Ga0439434_0008388
272 Ga0439440_0001042
273 Ga0495639_0029497
274 Ga0495608_0062006
275 Ga0495618_0015979
276 Ga0495630_0018898
277 Ga0495630_0289482
278 Ga0495666_0347618
279 Ga0495586_0109269
280 Ga0495621_0188261
281 Ga0495667_0406841
282 Ga0495635_0570267
283 Ga0495588_0051648
284 Ga0495647_0082699
285 Ga0495658_0083498
286 Ga0495613_0003070
287 Ga0495676_0233412
288 Ga0495614_0034733
289 Ga0495614_0059022
290 Ga0496110_0415196
291 Ga0501031_0198697
292 Ga0501034_0000559
293 Ga0501034_0065553
294 Ga0501036_0006922
295 Ga0501036_0262600
296 Ga0501037_0200182
297 Ga0501038_0032969
298 Ga0501038_0037707
299 Ga0501039_0002718
300 Ga0501039_0063340
301 Ga0501039_0222193
302 Ga0501040_0002330
303 Ga0501040_0005389
304 Ga0501041_0001182
305 Ga0501041_0001204
306 Ga0501042_0029395
307 Ga0501042_0139528
308 Ga0501046_0003584
309 Ga0501047_0172668
310 Ga0501048_0003122
311 Ga0501048_0031832
312 Ga0501067_0068402
313 Ga0501067_0244118
314 Ga0501068_0000033
315 Ga0501068_0006578
316 Ga0501069_0045286
317 Ga0501070_0001932
318 Ga0501070_0064534
319 Ga0501071_0004691
320 Ga0501071_0006204
321 Ga0501071_0185730
322 Ga0501072_0003914
323 Ga0501072_0004689
324 Ga0501072_0010756
325 Ga0501072_0091447
326 Ga0501072_0536131
327 Ga0501073_0002509
328 Ga0501073_0008764
329 Ga0501074_0008917
330 Ga0501074_0009412
331 Ga0501074_0041325
332 Ga0501074_0098490
333 Ga0501075_0004979
334 Ga0501076_0060948
335 Ga0501076_0078032
336 Ga0501076_0095754
337 Ga0501076_0864394
338 Ga0501077_0000583
339 Ga0501077_0000921
340 Ga0501077_0060534
341 Ga0501079_0022036
342 Ga0501080_0006455
343 Ga0501080_0064414
344 Ga0501080_0084365
345 Ga0501080_0214018
346 Ga0501081_0104837
347 Ga0501081_0226185
348 Ga0501083_0001744
349 Ga0501083_0028995
350 Ga0501035_0332673
351 Ga0501045_0000185
352 Ga0501045_0003101
353 nmdc:mga03n38_290341_c1
354 nmdc:mga03n38_443273_c1
355 nmdc:mga00v17_224755_c1
356 nmdc:mga00v17_291685_c1
357 nmdc:mga00v17_323729_c1
358 nmdc:mga05p37_3357_c1
359 nmdc:mga05p37_784774_c1
360 nmdc:mga09592_2879_c1
361 nmdc:mga09592_62376_c1
362 nmdc:mga09592_63882_c1
363 nmdc:mga0qj67_1777_c1
364 nmdc:mga0qj67_484246_c1
365 nmdc:mga0qj67_5813_c1
366 nmdc:mga0qj67_71282_c1
367 nmdc:mga06r32_121208_c1
368 nmdc:mga06r32_14406_c1
369 nmdc:mga06r32_234592_c1
370 nmdc:mga06r32_394969_c1
371 nmdc:mga06r32_5334_c1
372 nmdc:mga06r32_72483_c1
373 nmdc:mga08y16_10415_c1
374 nmdc:mga08y16_250088_c1
375 nmdc:mga08y16_90491_c1
376 Ga0495619_0126990
377 Ga0501084_0000517
378 Ga0501084_0009155
379 Ga0501084_0032966
380 Ga0501084_0274029
381 Ga0590074_020870
382 Ga0501082_0009631
383 Ga0501082_0340024
384 Ga0530510_0014889
385 Ga0530510_0028322
386 Ga0530510_0072446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06941

NT5C

5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)

5

191

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bwv-assembly1.cif.gz_A crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution 0.8012 6 188
3bwv-assembly1.cif.gz_B crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution 0.8012 8 188
3bwv-assembly1.cif.gz_A crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution 0.7883 6 188
3bwv-assembly1.cif.gz_B crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution 0.784 8 188
2jao-assembly1.cif.gz_A crystal structure of d12n variant of mouse cytosolic 5'(3')- deoxyribonucleotidase (cdn) in complex with deoxyguanosine 5'- monophosphate 0.7825 7 191
ID Description Score Start End Superfamily
af_Q9VNC7_651_1068_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8135 93 132 3.40.50.620
3bwvB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7942 8 188 3.40.50.1000
3bwvB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7705 8 188 3.40.50.1000
2lpkA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.7404 20 72 1.10.1200.10
2f9zD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;; 0.7239 107 133 3.30.1330.200
ID Description Score Start End GO Terms
AF-A0A358D0K3-F1-model_v4 5'-nucleotidase 0.9664 6 174 GO:0008253
GO:0009264
AF-A0A2V9RJZ8-F1-model_v4 5'-nucleotidase 0.9636 84 192 GO:0008253
GO:0009264
AF-A0A2E8LI98-F1-model_v4 5'-nucleotidase 0.9635 5 210 GO:0008253
GO:0009264
AF-A0A7X1PFS6-F1-model_v4 5'-nucleotidase 0.9625 7 191 GO:0008253
GO:0009264
AF-A0A376CNW1-F1-model_v4 Uncharacterized protein conserved in bacteria 0.9603 5 194 GO:0008253
GO:0009223

Map