F296833

General Info

Members Datasets Scaffolds Average Seq Length
193 135 386 116

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10223231|Ga0070681_102232312
Length 132
Sequence LTWARCPRYTYVVAKGSSGAPPKIDVLQGTLDLMILKTLESMGPQHGYGIARRIEQISDAVLKLNEGTVYASLMRLQHQGWISSRWGTSDNHRKAKFYTITRLGRRQLTRETETWERIAGVIHRLLRIAPQP

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
92 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
95 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
96 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
97 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
98 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
111 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
112 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
119 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
124 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.15
Rhizosphere 95.34
Stem 0
Stem Tuber 0
Unclassified 29.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10223231 3300005458 Bacteria 1799
2 Ga0065704_10842405 3300005289 Bacteria 512
3 Ga0065712_10069341 3300005290 Bacteria 7496
4 Ga0065715_10131491 3300005293 Bacteria 2007
5 Ga0065707_10112911 3300005295 Bacteria 2345
6 Ga0070658_10081499 3300005327 Bacteria 2658
7 Ga0070658_11821400 3300005327 Bacteria 526
8 Ga0070683_100060656 3300005329 Bacteria 3516
9 Ga0070690_100201736 3300005330 Bacteria 1384
10 Ga0070690_101791379 3300005330 Bacteria 500
11 Ga0070670_100094288 3300005331 Bacteria 2574
12 Ga0070670_101009506 3300005331 Bacteria 757
13 Ga0070666_10738053 3300005335 Bacteria 723
14 Ga0070682_101057609 3300005337 Unclassified 677
15 Ga0070661_100093229 3300005344 Bacteria 2231
16 Ga0070661_100452724 3300005344 Unclassified 1021
17 Ga0070668_101011399 3300005347 Unclassified 747
18 Ga0070669_100004239 3300005353 Bacteria 10367
19 Ga0070675_100225056 3300005354 Bacteria 1635
20 Ga0070671_100011588 3300005355 Bacteria 7093
21 Ga0070667_100114605 3300005367 Bacteria 2340
22 Ga0070713_100643690 3300005436 Bacteria 1009
23 Ga0070701_10266514 3300005438 Unclassified 1040
24 Ga0070711_100184739 3300005439 Unclassified 1598
25 Ga0070663_100044650 3300005455 Bacteria 3126
26 Ga0070678_100053491 3300005456 Bacteria 2936
27 Ga0070662_101718044 3300005457 Bacteria 542
28 Ga0070681_10251036 3300005458 Bacteria 1682
29 Ga0070685_10866666 3300005466 Unclassified 670
30 Ga0070706_100104415 3300005467 Bacteria 2635
31 Ga0070698_100133887 3300005471 Unclassified 2433
32 Ga0070698_100899770 3300005471 Unclassified 831
33 Ga0070684_100007004 3300005535 Bacteria 8759
34 Ga0070686_101119524 3300005544 Bacteria 651
35 Ga0070664_100317285 3300005564 Bacteria 1411
36 Ga0068859_102529297 3300005617 Unclassified 565
37 Ga0068866_10598177 3300005718 Unclassified 744
38 Ga0068861_100596212 3300005719 Bacteria 1013
39 Ga0068863_100423499 3300005841 Bacteria 1304
40 Ga0068858_102421005 3300005842 Bacteria 519
41 Ga0068862_100818404 3300005844 Unclassified 911
42 Ga0075428_100008410 3300006844 Bacteria 11445
43 Ga0075428_101271965 3300006844 Bacteria 774
44 Ga0075428_102050852 3300006844 Unclassified 592
45 Ga0075430_100015278 3300006846 Bacteria 6537
46 Ga0075430_100027196 3300006846 Bacteria 4862
47 Ga0075430_101505521 3300006846 Unclassified 553
48 Ga0075431_100002544 3300006847 Bacteria 17597
49 Ga0075431_100013858 3300006847 Bacteria 8144
50 Ga0075433_10242056 3300006852 Unclassified 1601
51 Ga0075433_10287529 3300006852 Bacteria 1456
52 Ga0075433_10568811 3300006852 Unclassified 996
53 Ga0075433_11245285 3300006852 Unclassified 645
54 Ga0075434_100111636 3300006871 Plasmid 2745
55 Ga0075434_100467263 3300006871 Unclassified 1283
56 Ga0075434_100914436 3300006871 Bacteria 892
57 Ga0075429_100093059 3300006880 Bacteria 2629
58 Ga0075429_101998691 3300006880 Unclassified 502
59 Ga0097620_102529299 3300006931 Unclassified 565
60 Ga0075435_100054860 3300007076 Unclassified 3217
61 Ga0075435_100147690 3300007076 Bacteria 1975
62 Ga0075435_100406361 3300007076 Unclassified 1171
63 Ga0105240_10044167 3300009093 Bacteria 5665
64 Ga0105240_10179269 3300009093 Unclassified 2502
65 Ga0111539_10022509 3300009094 Bacteria 7742
66 Ga0111539_10158519 3300009094 Bacteria 2648
67 Ga0105245_10544168 3300009098 Bacteria 1182
68 Ga0114129_10033417 3300009147 Bacteria 7269
69 Ga0114129_10105400 3300009147 Unclassified 3896
70 Ga0114129_10114563 3300009147 Bacteria 3717
71 Ga0114129_10145653 3300009147 Bacteria 3245
72 Ga0114129_10173851 3300009147 Bacteria 2934
73 Ga0114129_11853792 3300009147 Bacteria 732
74 Ga0105241_11031125 3300009174 Unclassified 771
75 Ga0105248_10052553 3300009177 Bacteria 4572
76 Ga0105248_10066132 3300009177 Bacteria 4059
77 Ga0105246_11236813 3300011119 Bacteria 689
78 Ga0157370_10269865 3300013104 Bacteria 1572
79 Ga0157370_10913226 3300013104 Bacteria 796
80 Ga0157374_10075403 3300013296 Bacteria 3187
81 Ga0157378_10993441 3300013297 Unclassified 873
82 Ga0163162_10669795 3300013306 Bacteria 1161
83 Ga0163163_10280361 3300014325 Bacteria 1718
84 Ga0157377_10616987 3300014745 Bacteria 776
85 Ga0157376_10297002 3300014969 Bacteria 1528
86 Ga0157376_10946816 3300014969 Unclassified 881
87 Ga0207697_10155757 3300025315 Bacteria 995
88 Ga0207688_10063272 3300025901 Bacteria 2087
89 Ga0207680_10706026 3300025903 Bacteria 723
90 Ga0207684_10212652 3300025910 Unclassified 1668
91 Ga0207707_10643724 3300025912 Bacteria 894
92 Ga0207707_11135382 3300025912 Unclassified 635
93 Ga0207695_10463118 3300025913 Bacteria 1151
94 Ga0207693_10527444 3300025915 Unclassified 921
95 Ga0207657_10012861 3300025919 Bacteria 8232
96 Ga0207650_10688150 3300025925 Bacteria 863
97 Ga0207659_10258278 3300025926 Bacteria 1416
98 Ga0207664_10607465 3300025929 Bacteria 982
99 Ga0207644_10039005 3300025931 Bacteria 3351
100 Ga0207704_10436932 3300025938 Bacteria 1041
101 Ga0207711_10116490 3300025941 Bacteria 2382
102 Ga0207661_10045245 3300025944 Bacteria 3483
103 Ga0207679_10406052 3300025945 Bacteria 1199
104 Ga0207651_10259846 3300025960 Bacteria 1425
105 Ga0207668_10974876 3300025972 Unclassified 757
106 Ga0207678_10073827 3300026067 Bacteria 2923
107 Ga0207683_10124586 3300026121 Bacteria 2315
108 Ga0207428_10013843 3300027907 Bacteria 7028
109 Ga0268265_10122943 3300028380 Unclassified 2142
110 Ga0307408_101195475 3300031548 Unclassified 709
111 Ga0307410_10222503 3300031852 Unclassified 1453
112 Ga0307412_10457118 3300031911 Bacteria 1053
113 Ga0307409_100227153 3300031995 Bacteria 1689
114 Ga0307416_100037653 3300032002 Bacteria 3724
115 Ga0307414_10627187 3300032004 Unclassified 967
116 Ga0307411_11785489 3300032005 Bacteria 571
117 Ga0373932_0397318 3300035112 Unclassified 533
118 Ga0373947_0102286 3300035725 Unclassified 1801
119 Ga0373947_0735034 3300035725 Bacteria 673
120 Ga0395905_0290153 3300037471 Bacteria 1523
121 Ga0436364_0066565 3300037853 Unclassified 636
122 Ga0439453_0040796 3300041408 Bacteria 909
123 Ga0439461_0079523 3300041410 Bacteria 772
124 Ga0439448_0292140 3300042005 Bacteria 578
125 Ga0450923_164411 3300042125 Bacteria 542
126 Ga0439434_0014432 3300042435 Bacteria 2350
127 Ga0439435_0035441 3300042436 Bacteria 1376
128 Ga0439435_0170815 3300042436 Bacteria 706
129 Ga0450918_062165 3300042531 Bacteria 691
130 Ga0439440_0236008 3300042993 Unclassified 553
131 Ga0466960_1006001 3300044901 Bacteria 512
132 Ga0495598_0314214 3300046537 Unclassified 595
133 Ga0495658_0589945 3300046683 Unclassified 712
134 Ga0496101_0326016 3300048904 Bacteria 1205
135 Ga0496104_0008372 3300048907 Bacteria 9190
136 Ga0496108_0010680 3300048911 Bacteria 7451
137 Ga0496109_0028512 3300048912 Bacteria 4993
138 Ga0496110_0093238 3300048913 Unclassified 2695
139 Ga0496111_0030199 3300048914 Bacteria 3854
140 Ga0496112_0006466 3300048915 Bacteria 10289
141 Ga0496113_0812552 3300048916 Bacteria 742
142 Ga0501292_003630 3300049515 Unclassified 2073
143 Ga0501299_023363 3300049522 Unclassified 1146
144 Ga0501300_017046 3300049523 Bacteria 1060
145 Ga0501036_1050152 3300049572 Bacteria 666
146 Ga0501071_0117464 3300049587 Bacteria 1970
147 Ga0501071_0370788 3300049587 Bacteria 1091
148 Ga0501071_0582814 3300049587 Bacteria 860
149 Ga0501073_0469520 3300049589 Bacteria 870
150 Ga0501075_0043961 3300049591 Bacteria 3351
151 Ga0501077_0336388 3300049593 Unclassified 963
152 Ga0501239_090613 3300049672 Unclassified 504
153 Ga0501229_060162 3300049706 Bacteria 577
154 Ga0501079_0776304 3300049741 Bacteria 754
155 Ga0501080_1035867 3300049742 Bacteria 711
156 Ga0501081_0446142 3300049743 Bacteria 961
157 Ga0501268_077413 3300049765 Bacteria 682
158 Ga0501279_034102 3300049775 Unclassified 762
159 Ga0501045_0047418 3300049824 Bacteria 3130
160 Ga0501045_0887229 3300049824 Bacteria 655
161 nmdc:mga05p37_102499_c1 3300050507 Bacteria 3524
162 nmdc:mga05p37_142455_c1 3300050507 Bacteria 2936
163 nmdc:mga05p37_204804_c1 3300050507 Bacteria 2387
164 nmdc:mga05p37_417207_c1 3300050507 Unclassified 1563
165 nmdc:mga05p37_85059_c1 3300050507 Bacteria 3897
166 nmdc:mga09592_332633_c1 3300050508 Unclassified 1315
167 nmdc:mga09592_578571_c1 3300050508 Bacteria 963
168 nmdc:mga09592_5992_c1 3300050508 Bacteria 9914
169 nmdc:mga0qj67_1085421_c1 3300050509 Bacteria 626
170 nmdc:mga0qj67_1503555_c1 3300050509 Unclassified 518
171 nmdc:mga0qj67_222022_c1 3300050509 Bacteria 1534
172 nmdc:mga0qj67_304_c1 3300050509 Bacteria 34204
173 nmdc:mga0qj67_657075_c1 3300050509 Unclassified 836
174 nmdc:mga0qj67_9163_c1 3300050509 Bacteria 7349
175 nmdc:mga06r32_127476_c1 3300050510 Bacteria 2515
176 nmdc:mga06r32_559825_c1 3300050510 Unclassified 1116
177 nmdc:mga06r32_6863_c1 3300050510 Bacteria 10233
178 nmdc:mga06r32_766479_c1 3300050510 Bacteria 927
179 nmdc:mga08y16_527570_c1 3300050511 Bacteria 1197
180 nmdc:mga08y16_937632_c1 3300050511 Unclassified 850
181 nmdc:mga0n895_141741_c1 3300050512 Unclassified 2432
182 nmdc:mga0n895_1663231_c1 3300050512 Unclassified 602
183 nmdc:mga0n895_212917_c1 3300050512 Bacteria 1962
184 nmdc:mga0rr50_458778_c1 3300050513 Bacteria 1081
185 nmdc:mga0rr50_588734_c1 3300050513 Bacteria 948
186 nmdc:mga0a205_1089010_c1 3300050515 Unclassified 646
187 nmdc:mga0a205_162659_c1 3300050515 Unclassified 2128
188 nmdc:mga0a205_220225_c1 3300050515 Bacteria 1784
189 nmdc:mga0a205_672001_c1 3300050515 Bacteria 886
190 Ga0501084_0141125 3300054114 Bacteria 2029
191 Ga0501084_0236608 3300054114 Bacteria 1542
192 Ga0501084_1073869 3300054114 Bacteria 676
193 Ga0501082_1980420 3300060353 Bacteria 508
194 Ga0070681_10223231
195 Ga0065704_10842405
196 Ga0065712_10069341
197 Ga0065715_10131491
198 Ga0065707_10112911
199 Ga0070658_10081499
200 Ga0070658_11821400
201 Ga0070683_100060656
202 Ga0070690_100201736
203 Ga0070690_101791379
204 Ga0070670_100094288
205 Ga0070670_101009506
206 Ga0070666_10738053
207 Ga0070682_101057609
208 Ga0070661_100093229
209 Ga0070661_100452724
210 Ga0070668_101011399
211 Ga0070669_100004239
212 Ga0070675_100225056
213 Ga0070671_100011588
214 Ga0070667_100114605
215 Ga0070713_100643690
216 Ga0070701_10266514
217 Ga0070711_100184739
218 Ga0070663_100044650
219 Ga0070678_100053491
220 Ga0070662_101718044
221 Ga0070681_10251036
222 Ga0070685_10866666
223 Ga0070706_100104415
224 Ga0070698_100133887
225 Ga0070698_100899770
226 Ga0070684_100007004
227 Ga0070686_101119524
228 Ga0070664_100317285
229 Ga0068859_102529297
230 Ga0068866_10598177
231 Ga0068861_100596212
232 Ga0068863_100423499
233 Ga0068858_102421005
234 Ga0068862_100818404
235 Ga0075428_100008410
236 Ga0075428_101271965
237 Ga0075428_102050852
238 Ga0075430_100015278
239 Ga0075430_100027196
240 Ga0075430_101505521
241 Ga0075431_100002544
242 Ga0075431_100013858
243 Ga0075433_10242056
244 Ga0075433_10287529
245 Ga0075433_10568811
246 Ga0075433_11245285
247 Ga0075434_100111636
248 Ga0075434_100467263
249 Ga0075434_100914436
250 Ga0075429_100093059
251 Ga0075429_101998691
252 Ga0097620_102529299
253 Ga0075435_100054860
254 Ga0075435_100147690
255 Ga0075435_100406361
256 Ga0105240_10044167
257 Ga0105240_10179269
258 Ga0111539_10022509
259 Ga0111539_10158519
260 Ga0105245_10544168
261 Ga0114129_10033417
262 Ga0114129_10105400
263 Ga0114129_10114563
264 Ga0114129_10145653
265 Ga0114129_10173851
266 Ga0114129_11853792
267 Ga0105241_11031125
268 Ga0105248_10052553
269 Ga0105248_10066132
270 Ga0105246_11236813
271 Ga0157370_10269865
272 Ga0157370_10913226
273 Ga0157374_10075403
274 Ga0157378_10993441
275 Ga0163162_10669795
276 Ga0163163_10280361
277 Ga0157377_10616987
278 Ga0157376_10297002
279 Ga0157376_10946816
280 Ga0207697_10155757
281 Ga0207688_10063272
282 Ga0207680_10706026
283 Ga0207684_10212652
284 Ga0207707_10643724
285 Ga0207707_11135382
286 Ga0207695_10463118
287 Ga0207693_10527444
288 Ga0207657_10012861
289 Ga0207650_10688150
290 Ga0207659_10258278
291 Ga0207664_10607465
292 Ga0207644_10039005
293 Ga0207704_10436932
294 Ga0207711_10116490
295 Ga0207661_10045245
296 Ga0207679_10406052
297 Ga0207651_10259846
298 Ga0207668_10974876
299 Ga0207678_10073827
300 Ga0207683_10124586
301 Ga0207428_10013843
302 Ga0268265_10122943
303 Ga0307408_101195475
304 Ga0307410_10222503
305 Ga0307412_10457118
306 Ga0307409_100227153
307 Ga0307416_100037653
308 Ga0307414_10627187
309 Ga0307411_11785489
310 Ga0373932_0397318
311 Ga0373947_0102286
312 Ga0373947_0735034
313 Ga0395905_0290153
314 Ga0436364_0066565
315 Ga0439453_0040796
316 Ga0439461_0079523
317 Ga0439448_0292140
318 Ga0450923_164411
319 Ga0439434_0014432
320 Ga0439435_0035441
321 Ga0439435_0170815
322 Ga0450918_062165
323 Ga0439440_0236008
324 Ga0466960_1006001
325 Ga0495598_0314214
326 Ga0495658_0589945
327 Ga0496101_0326016
328 Ga0496104_0008372
329 Ga0496108_0010680
330 Ga0496109_0028512
331 Ga0496110_0093238
332 Ga0496111_0030199
333 Ga0496112_0006466
334 Ga0496113_0812552
335 Ga0501292_003630
336 Ga0501299_023363
337 Ga0501300_017046
338 Ga0501036_1050152
339 Ga0501071_0117464
340 Ga0501071_0370788
341 Ga0501071_0582814
342 Ga0501073_0469520
343 Ga0501075_0043961
344 Ga0501077_0336388
345 Ga0501239_090613
346 Ga0501229_060162
347 Ga0501079_0776304
348 Ga0501080_1035867
349 Ga0501081_0446142
350 Ga0501268_077413
351 Ga0501279_034102
352 Ga0501045_0047418
353 Ga0501045_0887229
354 nmdc:mga05p37_102499_c1
355 nmdc:mga05p37_142455_c1
356 nmdc:mga05p37_204804_c1
357 nmdc:mga05p37_417207_c1
358 nmdc:mga05p37_85059_c1
359 nmdc:mga09592_332633_c1
360 nmdc:mga09592_578571_c1
361 nmdc:mga09592_5992_c1
362 nmdc:mga0qj67_1085421_c1
363 nmdc:mga0qj67_1503555_c1
364 nmdc:mga0qj67_222022_c1
365 nmdc:mga0qj67_304_c1
366 nmdc:mga0qj67_657075_c1
367 nmdc:mga0qj67_9163_c1
368 nmdc:mga06r32_127476_c1
369 nmdc:mga06r32_559825_c1
370 nmdc:mga06r32_6863_c1
371 nmdc:mga06r32_766479_c1
372 nmdc:mga08y16_527570_c1
373 nmdc:mga08y16_937632_c1
374 nmdc:mga0n895_141741_c1
375 nmdc:mga0n895_1663231_c1
376 nmdc:mga0n895_212917_c1
377 nmdc:mga0rr50_458778_c1
378 nmdc:mga0rr50_588734_c1
379 nmdc:mga0a205_1089010_c1
380 nmdc:mga0a205_162659_c1
381 nmdc:mga0a205_220225_c1
382 nmdc:mga0a205_672001_c1
383 Ga0501084_0141125
384 Ga0501084_0236608
385 Ga0501084_1073869
386 Ga0501082_1980420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

35

110

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9576 17 113
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9568 15 116
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9398 12 116
6abq-assembly1.cif.gz_B crystal structure of transcription factor from listeria monocytogenes 0.9338 15 116
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9337 15 113
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9335 16 107 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.93 12 116 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9249 16 116 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9172 19 90 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9106 17 89 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2N9N4Y2-F1-model_v4 Transcriptional regulator, PadR family 0.9887 16 115
AF-A0A2V8CZR8-F1-model_v4 PadR family transcriptional regulator 0.9827 23 115
AF-A0A6B9YSR4-F1-model_v4 PadR family transcriptional regulator 0.9808 8 114
AF-A0A2V9R0R6-F1-model_v4 PadR family transcriptional regulator 0.9797 23 115
AF-A0A1I6MNK1-F1-model_v4 Transcriptional regulator, PadR family 0.9759 8 114

Map