F296743

General Info

Members Datasets Scaffolds Average Seq Length
193 132 386 269

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100245452|Ga0070671_1002454522
Length 305
Sequence MVGPRYLARRPHLLLNTGTASEIGLSQSIITLTTDFGTSDHFVGTMRGVILNINPQARIYDICNAVQSYDVLDGALTIAHAYRYFPVDTIHMVIVDPGVGSARRPILVTTEKHKFIAPDNGVLSLVYEREERISVRHITAEHYFLQPTSQTFHGRDVFAAVAAWLSKGVEAAKFGEEVTDYVRFASPKVKKLNDRTAKGVVLKVDKFGNLVTNIRQEDIPQLTEELPPDFKIMIGRGEVKRVRKTYAEGAAGEIFGVWGSMGYLEIVANRAIAAQLLQATKGSDVGIVFETPQWEMNGAAATNGQ

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
32 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
53 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
64 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
65 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
66 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
67 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
70 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
83 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
90 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
91 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
92 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
99 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
130 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.07
Rhizosphere 89.12
Stem 0
Stem Tuber 0
Unclassified 25.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100245452 3300005355 Unclassified 1520
2 Ga0070683_100087157 3300005329 Bacteria 2928
3 Ga0070709_10056694 3300005434 Unclassified 2478
4 Ga0070709_10137158 3300005434 Bacteria 1677
5 Ga0070714_100234926 3300005435 Bacteria 1690
6 Ga0070714_100471054 3300005435 Unclassified 1195
7 Ga0070713_100078128 3300005436 Bacteria 2816
8 Ga0070711_100088544 3300005439 Unclassified 2225
9 Ga0070663_100012859 3300005455 Bacteria 5312
10 Ga0070684_100105022 3300005535 Bacteria 2527
11 Ga0070697_100003292 3300005536 Bacteria 12416
12 Ga0070697_100026878 3300005536 Bacteria 4601
13 Ga0070693_100068479 3300005547 Bacteria 2083
14 Ga0070665_100363298 3300005548 Bacteria 1454
15 Ga0068855_100006182 3300005563 Bacteria 14597
16 Ga0068855_100015457 3300005563 Bacteria 9188
17 Ga0068855_100749156 3300005563 Unclassified 1042
18 Ga0070664_100458433 3300005564 Bacteria 1171
19 Ga0068857_100426106 3300005577 Unclassified 1238
20 Ga0068856_100051012 3300005614 Bacteria 4080
21 Ga0068856_100389350 3300005614 Unclassified 1413
22 Ga0068864_100224049 3300005618 Bacteria 1736
23 Ga0068864_100334282 3300005618 Unclassified 1426
24 Ga0068863_100234291 3300005841 Bacteria 1771
25 Ga0068858_100286209 3300005842 Unclassified 1570
26 Ga0097621_100083288 3300006237 Bacteria 2665
27 Ga0075428_100597639 3300006844 Bacteria 1179
28 Ga0075436_100007427 3300006914 Bacteria 7494
29 Ga0075436_100007787 3300006914 Bacteria 7327
30 Ga0075436_100071414 3300006914 Unclassified 2400
31 Ga0075436_100170543 3300006914 Bacteria 1536
32 Ga0075435_100258941 3300007076 Bacteria 1482
33 Ga0075435_100350702 3300007076 Bacteria 1265
34 Ga0105240_10009186 3300009093 Bacteria 14020
35 Ga0111539_10082228 3300009094 Unclassified 3788
36 Ga0105248_10192398 3300009177 Bacteria 2299
37 Ga0105239_10424835 3300010375 Bacteria 1506
38 Ga0105239_10544497 3300010375 Bacteria 1321
39 Ga0157370_10433244 3300013104 Bacteria 1209
40 Ga0157369_10000739 3300013105 Bacteria 42128
41 Ga0157369_10007948 3300013105 Bacteria 12191
42 Ga0157369_10075726 3300013105 Bacteria 3607
43 Ga0163163_10001944 3300014325 Bacteria 17481
44 Ga0163163_10028662 3300014325 Bacteria 5350
45 Ga0163163_10065665 3300014325 Bacteria 3603
46 Ga0157376_10143818 3300014969 Bacteria 2143
47 Ga0213872_10000182 3300021361 Bacteria 56427
48 Ga0213874_10011370 3300021377 Bacteria 2253
49 Ga0213876_10012915 3300021384 Bacteria 4441
50 Ga0213876_10038496 3300021384 Bacteria 2524
51 Ga0213875_10038369 3300021388 Unclassified 2257
52 Ga0213875_10060113 3300021388 Unclassified 1778
53 Ga0213875_10194686 3300021388 Unclassified 953
54 Ga0207699_10065776 3300025906 Unclassified 2199
55 Ga0207699_10086687 3300025906 Bacteria 1956
56 Ga0207695_10328933 3300025913 Bacteria 1417
57 Ga0207663_10098139 3300025916 Unclassified 1961
58 Ga0207700_10079485 3300025928 Bacteria 2554
59 Ga0207700_10180529 3300025928 Bacteria 1767
60 Ga0207700_10262607 3300025928 Unclassified 1479
61 Ga0207664_10023202 3300025929 Unclassified 4645
62 Ga0207664_10086327 3300025929 Bacteria 2563
63 Ga0207664_10115085 3300025929 Bacteria 2242
64 Ga0207664_10242422 3300025929 Archaea 1570
65 Ga0207661_10063239 3300025944 Bacteria 2997
66 Ga0207679_10172971 3300025945 Bacteria 1780
67 Ga0207667_10015382 3300025949 Bacteria 8696
68 Ga0207667_10023999 3300025949 Bacteria 6707
69 Ga0207667_10043940 3300025949 Bacteria 4739
70 Ga0207703_10348355 3300026035 Unclassified 1363
71 Ga0207639_10055639 3300026041 Bacteria 3029
72 Ga0207678_10011625 3300026067 Bacteria 7733
73 Ga0207641_10340282 3300026088 Unclassified 1427
74 Ga0207676_10378157 3300026095 Unclassified 1317
75 Ga0207674_10199017 3300026116 Unclassified 1953
76 Ga0209971_1003104 3300027682 Bacteria 3965
77 Ga0209966_1016382 3300027695 Unclassified 1401
78 Ga0268266_10133004 3300028379 Bacteria 2226
79 Ga0265332_10049285 3300031238 Bacteria 1811
80 Ga0265325_10005705 3300031241 Bacteria 7653
81 Ga0265316_10217417 3300031344 Bacteria 1411
82 Ga0307408_100337918 3300031548 Bacteria 1274
83 Ga0265314_10004599 3300031711 Bacteria 12733
84 Ga0265342_10113526 3300031712 Bacteria 1531
85 Ga0373937_0120332 3300036401 Bacteria 2447
86 Ga0373937_0457022 3300036401 Bacteria 1213
87 Ga0395900_0313876 3300037418 Bacteria 1550
88 Ga0395905_0003751 3300037471 Bacteria 16098
89 Ga0395905_0022717 3300037471 Bacteria 5931
90 Ga0395905_0093327 3300037471 Unclassified 2823
91 Ga0395905_0112690 3300037471 Bacteria 2555
92 Ga0436364_0225671 3300037853 Bacteria 2749
93 Ga0436364_0342988 3300037853 Bacteria 7071
94 Ga0436364_0427320 3300037853 Unclassified 1579
95 Ga0436364_0714072 3300037853 Bacteria 3532
96 Ga0436364_1350595 3300037853 Bacteria 8723
97 Ga0436365_0399343 3300039437 Unclassified 3936
98 Ga0436365_0781995 3300039437 Bacteria 6534
99 Ga0436365_1235819 3300039437 Bacteria 1525
100 Ga0436365_1843119 3300039437 Bacteria 996
101 Ga0436361_0126076 3300039447 Bacteria 97470
102 Ga0436363_0160329 3300039450 Bacteria 3319
103 Ga0436363_0381197 3300039450 Unclassified 1663
104 Ga0436362_0200137 3300039453 Bacteria 4056
105 Ga0436362_1049970 3300039453 Bacteria 1787
106 Ga0439444_0004408 3300042437 Bacteria 2044
107 Ga0439460_0040377 3300042461 Bacteria 1367
108 Ga0451577_0001751 3300042876 Bacteria 27985
109 Ga0451577_0043290 3300042876 Bacteria 4033
110 Ga0439440_0037915 3300042993 Bacteria 1165
111 Ga0453683_0064116 3300044673 Unclassified 2296
112 Ga0466963_0001247 3300044694 Bacteria 13463
113 Ga0466963_0212847 3300044694 Bacteria 1353
114 Ga0453684_0000801 3300044712 Bacteria 107237
115 Ga0453684_0849975 3300044712 Unclassified 981
116 Ga0451576_0001797 3300045051 Bacteria 35108
117 Ga0451576_0113805 3300045051 Bacteria 2816
118 Ga0451576_0156129 3300045051 Unclassified 2380
119 Ga0451576_0400682 3300045051 Unclassified 1439
120 Ga0466958_0034767 3300045836 Bacteria 3009
121 Ga0466967_0013737 3300045976 Bacteria 6273
122 Ga0495662_0029856 3300046476 Bacteria 2631
123 Ga0495664_0029551 3300046477 Unclassified 3206
124 Ga0495618_0011534 3300046514 Bacteria 5362
125 Ga0495628_0008311 3300046516 Bacteria 8917
126 Ga0495665_0138127 3300046531 Bacteria 1274
127 Ga0495640_0060818 3300046533 Bacteria 2568
128 Ga0495586_0340595 3300046535 Bacteria 861
129 Ga0495587_0065888 3300046536 Unclassified 2114
130 Ga0495645_0001895 3300046543 Bacteria 14223
131 Ga0495667_0028438 3300046559 Bacteria 3764
132 Ga0495634_0073780 3300046642 Unclassified 2243
133 Ga0495635_0041985 3300046663 Unclassified 3160
134 Ga0495657_0037593 3300046675 Bacteria 3336
135 Ga0495657_0192858 3300046675 Unclassified 1244
136 Ga0495599_0005868 3300046678 Bacteria 7375
137 Ga0495623_0071312 3300046679 Unclassified 2162
138 Ga0495623_0090329 3300046679 Unclassified 1881
139 Ga0495646_0013147 3300046680 Bacteria 5261
140 Ga0495669_0020836 3300046684 Unclassified 2840
141 Ga0495669_0026722 3300046684 Bacteria 2523
142 Ga0495669_0074655 3300046684 Unclassified 1550
143 Ga0495669_0113234 3300046684 Bacteria 1268
144 Ga0495613_0043229 3300046689 Bacteria 3333
145 Ga0495613_0429826 3300046689 Bacteria 897
146 Ga0495600_0083128 3300046809 Bacteria 2090
147 Ga0495600_0223808 3300046809 Unclassified 1203
148 Ga0495604_0085967 3300047317 Unclassified 2346
149 Ga0495604_0107944 3300047317 Bacteria 2034
150 Ga0495636_0168928 3300047318 Unclassified 988
151 Ga0495680_0017686 3300047322 Bacteria 6074
152 Ga0495675_0008838 3300047444 Bacteria 6254
153 Ga0495675_0233132 3300047444 Bacteria 1110
154 Ga0495602_0031959 3300048088 Bacteria 4964
155 Ga0496108_0318841 3300048911 Unclassified 1355
156 Ga0496109_0055194 3300048912 Unclassified 3624
157 Ga0496112_0021732 3300048915 Bacteria 6104
158 Ga0496112_0715280 3300048915 Unclassified 929
159 Ga0501031_0001243 3300049568 Bacteria 15625
160 Ga0501032_0000837 3300049569 Bacteria 25024
161 Ga0501033_0012592 3300049570 Bacteria 6454
162 Ga0501036_0011297 3300049572 Bacteria 7387
163 Ga0501038_0150111 3300049574 Unclassified 1900
164 Ga0501039_0005686 3300049575 Bacteria 9445
165 Ga0501043_0005570 3300049579 Bacteria 10146
166 Ga0501046_0000591 3300049580 Bacteria 35671
167 Ga0501047_0061813 3300049581 Bacteria 3613
168 Ga0501048_0038859 3300049582 Unclassified 3415
169 Ga0501067_0019635 3300049583 Bacteria 3741
170 Ga0501068_0050644 3300049584 Unclassified 2510
171 Ga0501069_0000329 3300049585 Bacteria 21365
172 Ga0501070_0010268 3300049586 Bacteria 7919
173 Ga0501072_0001356 3300049588 Bacteria 18370
174 Ga0501073_0003261 3300049589 Bacteria 12180
175 Ga0501074_0018783 3300049590 Bacteria 5022
176 Ga0501076_0010896 3300049592 Bacteria 6763
177 Ga0501077_0001401 3300049593 Bacteria 14499
178 Ga0501079_0015630 3300049741 Bacteria 5796
179 Ga0501080_0000466 3300049742 Bacteria 31417
180 Ga0501083_0031908 3300049744 Bacteria 3613
181 Ga0501035_0008952 3300049822 Bacteria 9314
182 Ga0501044_0010485 3300049823 Bacteria 10056
183 nmdc:mga08y16_18820_c1 3300050511 Bacteria 7276
184 nmdc:mga0rr50_234877_c1 3300050513 Bacteria 1518
185 nmdc:mga0rr50_326367_c1 3300050513 Bacteria 1287
186 nmdc:mga08x19_10952_c1 3300050514 Bacteria 5455
187 nmdc:mga08x19_280382_c1 3300050514 Unclassified 1155
188 nmdc:mga08x19_7944_c1 3300050514 Bacteria 6304
189 nmdc:mga08x19_8223_c1 3300050514 Bacteria 6201
190 Ga0495619_0251323 3300053085 Bacteria 1225
191 Ga0501084_0006326 3300054114 Bacteria 9724
192 Ga0501082_0001516 3300060353 Bacteria 20457
193 Ga0501082_0026085 3300060353 Bacteria 5037
194 Ga0070671_100245452
195 Ga0070683_100087157
196 Ga0070709_10056694
197 Ga0070709_10137158
198 Ga0070714_100234926
199 Ga0070714_100471054
200 Ga0070713_100078128
201 Ga0070711_100088544
202 Ga0070663_100012859
203 Ga0070684_100105022
204 Ga0070697_100003292
205 Ga0070697_100026878
206 Ga0070693_100068479
207 Ga0070665_100363298
208 Ga0068855_100006182
209 Ga0068855_100015457
210 Ga0068855_100749156
211 Ga0070664_100458433
212 Ga0068857_100426106
213 Ga0068856_100051012
214 Ga0068856_100389350
215 Ga0068864_100224049
216 Ga0068864_100334282
217 Ga0068863_100234291
218 Ga0068858_100286209
219 Ga0097621_100083288
220 Ga0075428_100597639
221 Ga0075436_100007427
222 Ga0075436_100007787
223 Ga0075436_100071414
224 Ga0075436_100170543
225 Ga0075435_100258941
226 Ga0075435_100350702
227 Ga0105240_10009186
228 Ga0111539_10082228
229 Ga0105248_10192398
230 Ga0105239_10424835
231 Ga0105239_10544497
232 Ga0157370_10433244
233 Ga0157369_10000739
234 Ga0157369_10007948
235 Ga0157369_10075726
236 Ga0163163_10001944
237 Ga0163163_10028662
238 Ga0163163_10065665
239 Ga0157376_10143818
240 Ga0213872_10000182
241 Ga0213874_10011370
242 Ga0213876_10012915
243 Ga0213876_10038496
244 Ga0213875_10038369
245 Ga0213875_10060113
246 Ga0213875_10194686
247 Ga0207699_10065776
248 Ga0207699_10086687
249 Ga0207695_10328933
250 Ga0207663_10098139
251 Ga0207700_10079485
252 Ga0207700_10180529
253 Ga0207700_10262607
254 Ga0207664_10023202
255 Ga0207664_10086327
256 Ga0207664_10115085
257 Ga0207664_10242422
258 Ga0207661_10063239
259 Ga0207679_10172971
260 Ga0207667_10015382
261 Ga0207667_10023999
262 Ga0207667_10043940
263 Ga0207703_10348355
264 Ga0207639_10055639
265 Ga0207678_10011625
266 Ga0207641_10340282
267 Ga0207676_10378157
268 Ga0207674_10199017
269 Ga0209971_1003104
270 Ga0209966_1016382
271 Ga0268266_10133004
272 Ga0265332_10049285
273 Ga0265325_10005705
274 Ga0265316_10217417
275 Ga0307408_100337918
276 Ga0265314_10004599
277 Ga0265342_10113526
278 Ga0373937_0120332
279 Ga0373937_0457022
280 Ga0395900_0313876
281 Ga0395905_0003751
282 Ga0395905_0022717
283 Ga0395905_0093327
284 Ga0395905_0112690
285 Ga0436364_0225671
286 Ga0436364_0342988
287 Ga0436364_0427320
288 Ga0436364_0714072
289 Ga0436364_1350595
290 Ga0436365_0399343
291 Ga0436365_0781995
292 Ga0436365_1235819
293 Ga0436365_1843119
294 Ga0436361_0126076
295 Ga0436363_0160329
296 Ga0436363_0381197
297 Ga0436362_0200137
298 Ga0436362_1049970
299 Ga0439444_0004408
300 Ga0439460_0040377
301 Ga0451577_0001751
302 Ga0451577_0043290
303 Ga0439440_0037915
304 Ga0453683_0064116
305 Ga0466963_0001247
306 Ga0466963_0212847
307 Ga0453684_0000801
308 Ga0453684_0849975
309 Ga0451576_0001797
310 Ga0451576_0113805
311 Ga0451576_0156129
312 Ga0451576_0400682
313 Ga0466958_0034767
314 Ga0466967_0013737
315 Ga0495662_0029856
316 Ga0495664_0029551
317 Ga0495618_0011534
318 Ga0495628_0008311
319 Ga0495665_0138127
320 Ga0495640_0060818
321 Ga0495586_0340595
322 Ga0495587_0065888
323 Ga0495645_0001895
324 Ga0495667_0028438
325 Ga0495634_0073780
326 Ga0495635_0041985
327 Ga0495657_0037593
328 Ga0495657_0192858
329 Ga0495599_0005868
330 Ga0495623_0071312
331 Ga0495623_0090329
332 Ga0495646_0013147
333 Ga0495669_0020836
334 Ga0495669_0026722
335 Ga0495669_0074655
336 Ga0495669_0113234
337 Ga0495613_0043229
338 Ga0495613_0429826
339 Ga0495600_0083128
340 Ga0495600_0223808
341 Ga0495604_0085967
342 Ga0495604_0107944
343 Ga0495636_0168928
344 Ga0495680_0017686
345 Ga0495675_0008838
346 Ga0495675_0233132
347 Ga0495602_0031959
348 Ga0496108_0318841
349 Ga0496109_0055194
350 Ga0496112_0021732
351 Ga0496112_0715280
352 Ga0501031_0001243
353 Ga0501032_0000837
354 Ga0501033_0012592
355 Ga0501036_0011297
356 Ga0501038_0150111
357 Ga0501039_0005686
358 Ga0501043_0005570
359 Ga0501046_0000591
360 Ga0501047_0061813
361 Ga0501048_0038859
362 Ga0501067_0019635
363 Ga0501068_0050644
364 Ga0501069_0000329
365 Ga0501070_0010268
366 Ga0501072_0001356
367 Ga0501073_0003261
368 Ga0501074_0018783
369 Ga0501076_0010896
370 Ga0501077_0001401
371 Ga0501079_0015630
372 Ga0501080_0000466
373 Ga0501083_0031908
374 Ga0501035_0008952
375 Ga0501044_0010485
376 nmdc:mga08y16_18820_c1
377 nmdc:mga0rr50_234877_c1
378 nmdc:mga0rr50_326367_c1
379 nmdc:mga08x19_10952_c1
380 nmdc:mga08x19_280382_c1
381 nmdc:mga08x19_7944_c1
382 nmdc:mga08x19_8223_c1
383 Ga0495619_0251323
384 Ga0501084_0006326
385 Ga0501082_0001516
386 Ga0501082_0026085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01887

SAM_HAT_N

SAM hydroxide adenosyltransferase N-terminal domain

30

175

0.96

PF20257

SAM_HAT_C

SAM hydroxide adenosyltransferase C-terminal domain

199

286

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ryz-assembly1.cif.gz_A sall with s-adenosyl methionine 0.9125 2 243
2zbu-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermotoga maritima 0.9036 2 243
2q6o-assembly1.cif.gz_A sall-y70t with sam and cl 0.9016 2 243
6rz2-assembly1.cif.gz_B sall with chloroadenosine 0.9013 2 245
7xto-assembly1.cif.gz_C structure of cla2 reveal the mechanism of soil bacterial derived chlorinase 0.8994 2 242
ID Description Score Start End Superfamily
2q6oA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9417 2 139 3.40.50.10790
2zbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.94 2 139 3.40.50.10790
af_Q2FUT0_2_166_3.40.50.10790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9307 2 140 3.40.50.10790
1rqpB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9118 2 141 3.40.50.10790
1wu8A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.88 3 139 3.40.50.10790
ID Description Score Start End GO Terms
AF-A0A2V9P785-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase N-terminal domain-containing protein 0.9782 2 126
AF-A0A533Z9K4-F1-model_v4 SAM-dependent chlorinase/fluorinase 0.971 2 141
AF-A0A2V9PYM6-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase N-terminal domain-containing protein 0.9703 2 140
AF-A0A2V9KSP4-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase N-terminal domain-containing protein 0.9692 32 149
AF-A0A2N9N7X3-F1-model_v4 SAM-dependent chlorinase/fluorinase 0.9663 2 247

Map