F296339

General Info

Members Datasets Scaffolds Average Seq Length
192 143 384 137

Family's Representative Sequence

Representative Sequence 3300053083|Ga0495655_0105591|Ga0495655_0105591_35_454
Length 139
Sequence MLRGLSTVSFFADDLAAAKAWYSELLGVDAYFVRPEAGPPAYVEFRIGDYQHELGIIDSRYAPHSTSPAGAVIYWHVDDLKETYARLLALGAKENEAPVERGAGFVTASVVDPFGNILGIMYNQHYLDILAKPKAEDMA

Samples

Sample ID Description Type Environment
1 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
101 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
102 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
103 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
104 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
105 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
106 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
107 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
108 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
109 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
110 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
111 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
137 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
138 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
139 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
140 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
141 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
142 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
143 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.83
Metatranscriptomes 0
Isolates 4.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0.52
Rhizoplane 0.52
Rhizosphere 94.27
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495655_0105591 3300053083 Bacteria 840
2 rootH1_10083613 3300003323 Bacteria 3670
3 Ga0070670_100140484 3300005331 Bacteria 2088
4 Ga0068869_100008045 3300005334 Bacteria 6773
5 Ga0070660_100789233 3300005339 Bacteria 798
6 Ga0070687_100391653 3300005343 Bacteria 908
7 Ga0070692_10031410 3300005345 Bacteria 2662
8 Ga0070669_100224625 3300005353 Bacteria 1486
9 Ga0070675_100005293 3300005354 Bacteria 9857
10 Ga0070659_100729125 3300005366 Bacteria 858
11 Ga0070714_100227560 3300005435 Bacteria 1717
12 Ga0070714_100441297 3300005435 Bacteria 1235
13 Ga0070713_100015512 3300005436 Bacteria 5701
14 Ga0070713_100043264 3300005436 Bacteria 3681
15 Ga0070713_100192900 3300005436 Bacteria 1837
16 Ga0070713_100749076 3300005436 Bacteria 934
17 Ga0070701_10608832 3300005438 Bacteria 724
18 Ga0070711_100118176 3300005439 Bacteria 1956
19 Ga0070700_100059991 3300005441 Bacteria 2396
20 Ga0070694_100512015 3300005444 Bacteria 956
21 Ga0070708_100027626 3300005445 Bacteria 4871
22 Ga0070678_100229096 3300005456 Bacteria 1548
23 Ga0070662_100764122 3300005457 Bacteria 820
24 Ga0070681_10277413 3300005458 Bacteria 1587
25 Ga0070685_10848928 3300005466 Bacteria 676
26 Ga0070706_100288902 3300005467 Bacteria 1530
27 Ga0070707_100089369 3300005468 Bacteria 2981
28 Ga0070707_100200046 3300005468 Bacteria 1947
29 Ga0070698_100010178 3300005471 Bacteria 10048
30 Ga0070698_100014092 3300005471 Bacteria 8454
31 Ga0070698_101061690 3300005471 Bacteria 758
32 Ga0070699_100005073 3300005518 Bacteria 11593
33 Ga0070679_101962573 3300005530 Bacteria 534
34 Ga0070684_100398821 3300005535 Bacteria 1268
35 Ga0070697_100003957 3300005536 Bacteria 11382
36 Ga0070672_100061388 3300005543 Bacteria 2963
37 Ga0070693_100575037 3300005547 Bacteria 810
38 Ga0070664_100000319 3300005564 Bacteria 34990
39 Ga0068857_100273070 3300005577 Bacteria 1554
40 Ga0068861_100056224 3300005719 Bacteria 3003
41 Ga0068862_100021854 3300005844 Bacteria 5350
42 Ga0081455_10001393 3300005937 Bacteria 29861
43 Ga0081455_10053420 3300005937 Bacteria 3451
44 Ga0081455_10370014 3300005937 Bacteria 1005
45 Ga0081538_10000264 3300005981 Bacteria 59881
46 Ga0081538_10000675 3300005981 Bacteria 37492
47 Ga0081539_10005930 3300005985 Bacteria 12065
48 Ga0070712_100144042 3300006175 Bacteria 1822
49 Ga0070712_100429828 3300006175 Bacteria 1096
50 Ga0075428_100011273 3300006844 Bacteria 9943
51 Ga0075428_101623093 3300006844 Bacteria 676
52 Ga0075430_100165893 3300006846 Bacteria 1838
53 Ga0075431_100022107 3300006847 Bacteria 6505
54 Ga0075431_101569365 3300006847 Bacteria 616
55 Ga0075435_100030127 3300007076 Bacteria 4263
56 Ga0105240_10795535 3300009093 Bacteria 1025
57 Ga0111539_10003666 3300009094 Bacteria 20226
58 Ga0111539_10005171 3300009094 Bacteria 16907
59 Ga0105245_10005040 3300009098 Bacteria 11616
60 Ga0105247_11481018 3300009101 Bacteria 553
61 Ga0114129_10399859 3300009147 Bacteria 1810
62 Ga0114129_11021264 3300009147 Bacteria 1040
63 Ga0105243_10027530 3300009148 Bacteria 4356
64 Ga0105243_10212804 3300009148 Bacteria 1703
65 Ga0105243_11091506 3300009148 Bacteria 806
66 Ga0105237_11221471 3300009545 Bacteria 758
67 Ga0105249_10191260 3300009553 Bacteria 1997
68 Ga0105246_10234319 3300011119 Bacteria 1447
69 Ga0182008_10152186 3300014497 Bacteria 1161
70 Ga0157377_10009359 3300014745 Bacteria 4802
71 Ga0207692_10170566 3300025898 Bacteria 1261
72 Ga0207684_10054404 3300025910 Bacteria 3395
73 Ga0207684_10324783 3300025910 Bacteria 1326
74 Ga0207671_10293684 3300025914 Bacteria 1283
75 Ga0207671_11069255 3300025914 Bacteria 634
76 Ga0207693_10052591 3300025915 Bacteria 3195
77 Ga0207662_10414900 3300025918 Bacteria 915
78 Ga0207649_10768713 3300025920 Bacteria 750
79 Ga0207646_10032925 3300025922 Bacteria 4688
80 Ga0207646_10538250 3300025922 Bacteria 1051
81 Ga0207650_10224329 3300025925 Bacteria 1513
82 Ga0207659_10010972 3300025926 Bacteria 5707
83 Ga0207687_10912550 3300025927 Bacteria 752
84 Ga0207700_10008084 3300025928 Bacteria 6490
85 Ga0207700_10345184 3300025928 Bacteria 1295
86 Ga0207664_10018253 3300025929 Bacteria 5159
87 Ga0207664_10240519 3300025929 Bacteria 1576
88 Ga0207690_10080182 3300025932 Bacteria 2277
89 Ga0207706_10686819 3300025933 Bacteria 875
90 Ga0207709_10005237 3300025935 Bacteria 7380
91 Ga0207665_10382790 3300025939 Bacteria 1068
92 Ga0207689_10020241 3300025942 Bacteria 5603
93 Ga0207679_10006410 3300025945 Bacteria 7433
94 Ga0207712_10070406 3300025961 Bacteria 2512
95 Ga0207668_10910182 3300025972 Bacteria 783
96 Ga0207708_10007133 3300026075 Bacteria 8259
97 Ga0207674_10007646 3300026116 Bacteria 12586
98 Ga0207675_100371634 3300026118 Bacteria 1405
99 Ga0207428_10000102 3300027907 Bacteria 118940
100 Ga0268265_11381253 3300028380 Bacteria 706
101 Ga0307408_100018661 3300031548 Bacteria 4660
102 Ga0307508_10002384 3300031616 Bacteria 19866
103 Ga0307405_10003937 3300031731 Bacteria 6944
104 Ga0307413_10240164 3300031824 Bacteria 1337
105 Ga0307410_10011148 3300031852 Bacteria 5127
106 Ga0307406_10005754 3300031901 Bacteria 6793
107 Ga0307406_10117564 3300031901 Bacteria 1842
108 Ga0307406_10338353 3300031901 Bacteria 1171
109 Ga0307407_10033880 3300031903 Bacteria 2790
110 Ga0307412_10023822 3300031911 Bacteria 3772
111 Ga0307409_100000050 3300031995 Bacteria 42042
112 Ga0307409_100066985 3300031995 Bacteria 2834
113 Ga0307409_100456605 3300031995 Bacteria 1234
114 Ga0307409_100523104 3300031995 Bacteria 1159
115 Ga0307409_101746396 3300031995 Bacteria 651
116 Ga0307416_100000150 3300032002 Bacteria 41366
117 Ga0307416_100159385 3300032002 Bacteria 2083
118 Ga0307416_100160765 3300032002 Bacteria 2076
119 Ga0307416_101063856 3300032002 Bacteria 913
120 Ga0307416_102653844 3300032002 Bacteria 598
121 Ga0307414_10215577 3300032004 Bacteria 1572
122 Ga0307414_10385384 3300032004 Bacteria 1213
123 Ga0307411_10019042 3300032005 Bacteria 3955
124 Ga0307411_10027113 3300032005 Bacteria 3461
125 Ga0307415_100031578 3300032126 Bacteria 3414
126 Ga0307415_100211356 3300032126 Bacteria 1548
127 Ga0307415_100865248 3300032126 Bacteria 830
128 Ga0373933_0116705 3300035724 Bacteria 1669
129 Ga0373937_0200735 3300036401 Bacteria 1875
130 Ga0373937_0580845 3300036401 Bacteria 1064
131 Ga0373925_0128104 3300037068 Bacteria 1977
132 Ga0395899_0395285 3300037312 Bacteria 916
133 Ga0395899_0926160 3300037312 Bacteria 530
134 Ga0395900_0599513 3300037418 Bacteria 1042
135 Ga0395898_0109854 3300037466 Bacteria 2643
136 Ga0395898_1084025 3300037466 Bacteria 735
137 Ga0395905_0012713 3300037471 Bacteria 8097
138 Ga0395901_0011944 3300038443 Bacteria 8806
139 Ga0395901_0305398 3300038443 Bacteria 1649
140 Ga0439448_0011573 3300042005 Bacteria 2631
141 Ga0439450_070822 3300042008 Unclassified 855
142 Ga0439450_104747 3300042008 Bacteria 720
143 Ga0439463_004308 3300042016 Bacteria 3569
144 Ga0439463_138365 3300042016 Bacteria 630
145 Ga0450888_005774 3300042126 Bacteria 1330
146 Ga0450900_001420 3300042136 Bacteria 2331
147 Ga0439458_0028488 3300042157 Bacteria 1322
148 Ga0439435_0004572 3300042436 Bacteria 2994
149 Ga0439444_0001270 3300042437 Bacteria 3218
150 Ga0439459_0017099 3300042438 Bacteria 1347
151 Ga0439464_0030943 3300042439 Unclassified 1500
152 Ga0439464_0034264 3300042439 Bacteria 1431
153 Ga0439460_0015485 3300042461 Bacteria 2020
154 Ga0439460_0138327 3300042461 Bacteria 806
155 Ga0439440_0011043 3300042993 Unclassified 1899
156 Ga0439440_0015930 3300042993 Bacteria 1639
157 Ga0439440_0017983 3300042993 Bacteria 1561
158 Ga0466972_0002020 3300044658 Bacteria 9937
159 Ga0466965_0000294 3300044683 Bacteria 16568
160 Ga0466963_0012560 3300044694 Bacteria 5188
161 Ga0453684_0007921 3300044712 Bacteria 19271
162 Ga0466968_0020553 3300044735 Bacteria 2666
163 Ga0466968_0161733 3300044735 Bacteria 1034
164 Ga0466960_0000941 3300044901 Bacteria 10301
165 Ga0466959_0103163 3300045049 Bacteria 2041
166 Ga0466967_0381315 3300045976 Bacteria 1369
167 Ga0495618_0280804 3300046514 Bacteria 1039
168 Ga0495652_0750594 3300046529 Bacteria 653
169 Ga0495656_0232409 3300046615 Bacteria 926
170 Ga0495646_0710299 3300046680 Bacteria 505
171 Ga0495680_0852396 3300047322 Bacteria 592
172 Ga0496101_0421126 3300048904 Bacteria 1053
173 Ga0496126_0015149 3300048929 Bacteria 7766
174 Ga0496126_0026569 3300048929 Bacteria 5548
175 Ga0501039_0728985 3300049575 Bacteria 775
176 Ga0501072_0842571 3300049588 Bacteria 717
177 Ga0501076_1642475 3300049592 Bacteria 527
178 nmdc:mga00v17_248875_c1 3300050491 Bacteria 1152
179 nmdc:mga06r32_23701_c1 3300050510 Bacteria 5683
180 nmdc:mga08y16_109941_c1 3300050511 Bacteria 2870
181 nmdc:mga08y16_37924_c1 3300050511 Bacteria 5060
182 nmdc:mga0n895_1796_c1 3300050512 Bacteria 16300
183 nmdc:mga0rr50_84639_c1 3300050513 Bacteria 2456
184 nmdc:mga08x19_829_c1 3300050514 Bacteria 19627
185 2515851461 2515154155 Bacteria 7985436
186 2739237814 2738543011 Bacteria 5731169
187 2866619235 2866612099 Bacteria 7543886
188 2868092684 2868088558 Bacteria 7609351
189 2889303672 2889300758 Bacteria 5690814
190 2939747456 2939743619 Bacteria 5762299
191 8055175262 8055172936 Bacteria 9305943
192 8055414892 8055412473 Bacteria 6257500
193 Ga0495655_0105591
194 rootH1_10083613
195 Ga0070670_100140484
196 Ga0068869_100008045
197 Ga0070660_100789233
198 Ga0070687_100391653
199 Ga0070692_10031410
200 Ga0070669_100224625
201 Ga0070675_100005293
202 Ga0070659_100729125
203 Ga0070714_100227560
204 Ga0070714_100441297
205 Ga0070713_100015512
206 Ga0070713_100043264
207 Ga0070713_100192900
208 Ga0070713_100749076
209 Ga0070701_10608832
210 Ga0070711_100118176
211 Ga0070700_100059991
212 Ga0070694_100512015
213 Ga0070708_100027626
214 Ga0070678_100229096
215 Ga0070662_100764122
216 Ga0070681_10277413
217 Ga0070685_10848928
218 Ga0070706_100288902
219 Ga0070707_100089369
220 Ga0070707_100200046
221 Ga0070698_100010178
222 Ga0070698_100014092
223 Ga0070698_101061690
224 Ga0070699_100005073
225 Ga0070679_101962573
226 Ga0070684_100398821
227 Ga0070697_100003957
228 Ga0070672_100061388
229 Ga0070693_100575037
230 Ga0070664_100000319
231 Ga0068857_100273070
232 Ga0068861_100056224
233 Ga0068862_100021854
234 Ga0081455_10001393
235 Ga0081455_10053420
236 Ga0081455_10370014
237 Ga0081538_10000264
238 Ga0081538_10000675
239 Ga0081539_10005930
240 Ga0070712_100144042
241 Ga0070712_100429828
242 Ga0075428_100011273
243 Ga0075428_101623093
244 Ga0075430_100165893
245 Ga0075431_100022107
246 Ga0075431_101569365
247 Ga0075435_100030127
248 Ga0105240_10795535
249 Ga0111539_10003666
250 Ga0111539_10005171
251 Ga0105245_10005040
252 Ga0105247_11481018
253 Ga0114129_10399859
254 Ga0114129_11021264
255 Ga0105243_10027530
256 Ga0105243_10212804
257 Ga0105243_11091506
258 Ga0105237_11221471
259 Ga0105249_10191260
260 Ga0105246_10234319
261 Ga0182008_10152186
262 Ga0157377_10009359
263 Ga0207692_10170566
264 Ga0207684_10054404
265 Ga0207684_10324783
266 Ga0207671_10293684
267 Ga0207671_11069255
268 Ga0207693_10052591
269 Ga0207662_10414900
270 Ga0207649_10768713
271 Ga0207646_10032925
272 Ga0207646_10538250
273 Ga0207650_10224329
274 Ga0207659_10010972
275 Ga0207687_10912550
276 Ga0207700_10008084
277 Ga0207700_10345184
278 Ga0207664_10018253
279 Ga0207664_10240519
280 Ga0207690_10080182
281 Ga0207706_10686819
282 Ga0207709_10005237
283 Ga0207665_10382790
284 Ga0207689_10020241
285 Ga0207679_10006410
286 Ga0207712_10070406
287 Ga0207668_10910182
288 Ga0207708_10007133
289 Ga0207674_10007646
290 Ga0207675_100371634
291 Ga0207428_10000102
292 Ga0268265_11381253
293 Ga0307408_100018661
294 Ga0307508_10002384
295 Ga0307405_10003937
296 Ga0307413_10240164
297 Ga0307410_10011148
298 Ga0307406_10005754
299 Ga0307406_10117564
300 Ga0307406_10338353
301 Ga0307407_10033880
302 Ga0307412_10023822
303 Ga0307409_100000050
304 Ga0307409_100066985
305 Ga0307409_100456605
306 Ga0307409_100523104
307 Ga0307409_101746396
308 Ga0307416_100000150
309 Ga0307416_100159385
310 Ga0307416_100160765
311 Ga0307416_101063856
312 Ga0307416_102653844
313 Ga0307414_10215577
314 Ga0307414_10385384
315 Ga0307411_10019042
316 Ga0307411_10027113
317 Ga0307415_100031578
318 Ga0307415_100211356
319 Ga0307415_100865248
320 Ga0373933_0116705
321 Ga0373937_0200735
322 Ga0373937_0580845
323 Ga0373925_0128104
324 Ga0395899_0395285
325 Ga0395899_0926160
326 Ga0395900_0599513
327 Ga0395898_0109854
328 Ga0395898_1084025
329 Ga0395905_0012713
330 Ga0395901_0011944
331 Ga0395901_0305398
332 Ga0439448_0011573
333 Ga0439450_070822
334 Ga0439450_104747
335 Ga0439463_004308
336 Ga0439463_138365
337 Ga0450888_005774
338 Ga0450900_001420
339 Ga0439458_0028488
340 Ga0439435_0004572
341 Ga0439444_0001270
342 Ga0439459_0017099
343 Ga0439464_0030943
344 Ga0439464_0034264
345 Ga0439460_0015485
346 Ga0439460_0138327
347 Ga0439440_0011043
348 Ga0439440_0015930
349 Ga0439440_0017983
350 Ga0466972_0002020
351 Ga0466965_0000294
352 Ga0466963_0012560
353 Ga0453684_0007921
354 Ga0466968_0020553
355 Ga0466968_0161733
356 Ga0466960_0000941
357 Ga0466959_0103163
358 Ga0466967_0381315
359 Ga0495618_0280804
360 Ga0495652_0750594
361 Ga0495656_0232409
362 Ga0495646_0710299
363 Ga0495680_0852396
364 Ga0496101_0421126
365 Ga0496126_0015149
366 Ga0496126_0026569
367 Ga0501039_0728985
368 Ga0501072_0842571
369 Ga0501076_1642475
370 nmdc:mga00v17_248875_c1
371 nmdc:mga06r32_23701_c1
372 nmdc:mga08y16_109941_c1
373 nmdc:mga08y16_37924_c1
374 nmdc:mga0n895_1796_c1
375 nmdc:mga0rr50_84639_c1
376 nmdc:mga08x19_829_c1
377 2515851461
378 2739237814
379 2866619235
380 2868092684
381 2889303672
382 2939747456
383 8055175262
384 8055414892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

120

0.89

PF18029

Glyoxalase_6

Glyoxalase-like domain

7

121

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.815 2 125
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8102 5 125
2kjz-assembly1.cif.gz_B solution nmr structure of protein atc0852 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg) target att2. 0.8025 2 120
4pav-assembly1.cif.gz_A structure of hypothetical protein sa1046 from s. aureus. 0.7995 1 119
4pav-assembly6.cif.gz_F structure of hypothetical protein sa1046 from s. aureus. 0.7959 1 119
ID Description Score Start End Superfamily
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9496 7 52 3.30.720.120
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8417 69 120 3.30.720.110
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8386 2 55 3.30.720.120
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8114 2 55 3.30.720.120
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8018 66 118 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A2A8CT13-F1-model_v4 deleted 0.9614 12 110
AF-C2SKZ2-F1-model_v4 deleted 0.9612 2 128
AF-A0A7K4BBD5-F1-model_v4 VOC family protein 0.9543 18 128
AF-A0A2A8CT13-F1-model_v4 deleted 0.9521 12 110
AF-A0A1L6LLQ1-F1-model_v4 deleted 0.9514 2 128

Map