F296030

General Info

Members Datasets Scaffolds Average Seq Length
192 124 384 382

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0118579|Ga0451577_0118579_583_1860
Length 425
Sequence MAYELFISLRYLRARRKQVFVSIITFISIAGIFLGVAALIIVIAVMSGFENDLRSKILGINSHIVLMEHTGGMRDHARVHEEVTKIPGVVAATPFIYSQAMLKNGNSVTGIVLRGLSTTDALKVINLGKIREGRLDYLQDGKKNIPGLKPDLSDLPGIIIGRELAKNLGVFLFETVHIVSPSGISTPMGMVPRMKPFVVVGIFESGFYEYDSTLAYISLKTCQEFLNMGDLVTGLEIRVDDIYQADGIAKTIERKLGYPYWARNWMEMNRNLFSALRLEKRVMFIILSLIVLVAAFNIISALIMIVMEKNKDIAILKTMGATRRDIMKIFIFQGIIVGALGTFLGCLAGLSVALNLEALSRFVEKIFGFKILPGDVYYLSELPSQVNYADVGIILGGTMLICFLATIYPSWRASRLDPAEALRYD

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
90 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
91 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
92 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
124 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.69
Nodule 0
Rhizoplane 3.65
Rhizosphere 90.62
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0118579 3300042876 Bacteria 2370
2 JGI24751J29686_10000924 3300002459 Bacteria 6612
3 Ga0065712_10075349 3300005290 Bacteria 3880
4 Ga0065712_10075394 3300005290 Bacteria 3848
5 Ga0065715_10007153 3300005293 Bacteria 3149
6 Ga0065715_10118781 3300005293 Bacteria 2304
7 Ga0065707_10143735 3300005295 Bacteria 1739
8 Ga0070683_100003797 3300005329 Bacteria 12336
9 Ga0068869_100019368 3300005334 Bacteria 4648
10 Ga0070680_100101038 3300005336 Bacteria 2394
11 Ga0070660_100233520 3300005339 Bacteria 1496
12 Ga0070689_100134286 3300005340 Bacteria 1986
13 Ga0070661_100008910 3300005344 Bacteria 6944
14 Ga0070668_100320947 3300005347 Bacteria 1304
15 Ga0070669_100077736 3300005353 Bacteria 2466
16 Ga0070671_100018437 3300005355 Bacteria 5668
17 Ga0070674_100010094 3300005356 Bacteria 5689
18 Ga0070659_100021883 3300005366 Bacteria 4877
19 Ga0070694_100052153 3300005444 Bacteria 2764
20 Ga0070681_10008229 3300005458 Bacteria 10205
21 Ga0070698_100116148 3300005471 Bacteria 2640
22 Ga0070679_100094947 3300005530 Bacteria 2970
23 Ga0070684_100000897 3300005535 Bacteria 21069
24 Ga0070672_100066703 3300005543 Bacteria 2850
25 Ga0070696_100212979 3300005546 Bacteria 1447
26 Ga0070693_100018764 3300005547 Bacteria 3617
27 Ga0070665_100366029 3300005548 Unclassified 1448
28 Ga0070704_100016185 3300005549 Bacteria 4707
29 Ga0070704_100154673 3300005549 Bacteria 1807
30 Ga0070664_100003663 3300005564 Bacteria 12374
31 Ga0068859_100052212 3300005617 Bacteria 4110
32 Ga0068859_100370769 3300005617 Bacteria 1527
33 Ga0068864_100019868 3300005618 Bacteria 5618
34 Ga0068861_100089600 3300005719 Bacteria 2425
35 Ga0068863_100002664 3300005841 Bacteria 17652
36 Ga0068863_100086008 3300005841 Bacteria 2979
37 Ga0068858_100028570 3300005842 Bacteria 5179
38 Ga0068858_100112801 3300005842 Bacteria 2539
39 Ga0068860_100161590 3300005843 Bacteria 2160
40 Ga0068862_100161889 3300005844 Bacteria 1998
41 Ga0081455_10065637 3300005937 Bacteria 3034
42 Ga0075368_10015549 3300006042 Bacteria 2825
43 Ga0075363_100057537 3300006048 Bacteria 2087
44 Ga0075367_10000639 3300006178 Bacteria 13431
45 Ga0075367_10004903 3300006178 Bacteria 6592
46 Ga0075366_10028923 3300006195 Bacteria 3254
47 Ga0075366_10032118 3300006195 Bacteria 3090
48 Ga0068871_100136733 3300006358 Bacteria 2082
49 Ga0075428_100057392 3300006844 Bacteria 4262
50 Ga0075428_100073464 3300006844 Bacteria 3735
51 Ga0075428_100145856 3300006844 Bacteria 2572
52 Ga0075430_100091331 3300006846 Bacteria 2546
53 Ga0075430_100183606 3300006846 Unclassified 1739
54 Ga0075431_100008888 3300006847 Bacteria 10066
55 Ga0075431_100026960 3300006847 Bacteria 5894
56 Ga0075431_100051952 3300006847 Bacteria 4226
57 Ga0075431_100072437 3300006847 Bacteria 3555
58 Ga0075433_10065769 3300006852 Bacteria 3180
59 Ga0075434_100123618 3300006871 Bacteria 2604
60 Ga0075429_100108352 3300006880 Bacteria 2428
61 Ga0075429_100110832 3300006880 Bacteria 2399
62 Ga0075429_100128902 3300006880 Bacteria 2213
63 Ga0097620_100052212 3300006931 Bacteria 4110
64 Ga0111539_10001388 3300009094 Bacteria 32201
65 Ga0111539_10001947 3300009094 Bacteria 27542
66 Ga0111539_10046369 3300009094 Bacteria 5198
67 Ga0111539_10046460 3300009094 Bacteria 5193
68 Ga0111539_10071583 3300009094 Bacteria 4090
69 Ga0111539_10090540 3300009094 Bacteria 3595
70 Ga0111539_10179524 3300009094 Bacteria 2473
71 Ga0114129_10007438 3300009147 Bacteria 15600
72 Ga0114129_10053442 3300009147 Bacteria 5664
73 Ga0114129_10072839 3300009147 Bacteria 4788
74 Ga0114129_10091626 3300009147 Bacteria 4211
75 Ga0114129_10127178 3300009147 Bacteria 3503
76 Ga0114129_10162603 3300009147 Bacteria 3048
77 Ga0114129_10169208 3300009147 Bacteria 2980
78 Ga0114129_10485541 3300009147 Bacteria 1616
79 Ga0105248_10019606 3300009177 Bacteria 7485
80 Ga0105248_10035645 3300009177 Bacteria 5566
81 Ga0105248_10393253 3300009177 Bacteria 1561
82 Ga0163162_10103027 3300013306 Bacteria 2948
83 Ga0163163_10019026 3300014325 Bacteria 6444
84 Ga0163163_10244642 3300014325 Bacteria 1844
85 Ga0157380_10020151 3300014326 Bacteria 4982
86 Ga0157380_10026251 3300014326 Bacteria 4422
87 Ga0157380_10029546 3300014326 Bacteria 4189
88 Ga0157379_10061661 3300014968 Bacteria 3353
89 Ga0157379_10178160 3300014968 Bacteria 1920
90 Ga0207707_10007024 3300025912 Bacteria 9820
91 Ga0207660_10086193 3300025917 Bacteria 2318
92 Ga0207649_10022329 3300025920 Bacteria 3654
93 Ga0207652_10245007 3300025921 Bacteria 1616
94 Ga0207650_10153846 3300025925 Bacteria 1817
95 Ga0207690_10057202 3300025932 Bacteria 2634
96 Ga0207706_10150757 3300025933 Bacteria 2045
97 Ga0207706_10194039 3300025933 Bacteria 1782
98 Ga0207669_10091972 3300025937 Bacteria 1978
99 Ga0207711_10173131 3300025941 Bacteria 1960
100 Ga0207661_10079921 3300025944 Bacteria 2696
101 Ga0207679_10106127 3300025945 Bacteria 2207
102 Ga0207712_10215860 3300025961 Bacteria 1531
103 Ga0207668_10255396 3300025972 Bacteria 1426
104 Ga0207640_10136563 3300025981 Bacteria 1781
105 Ga0207703_10092470 3300026035 Bacteria 2546
106 Ga0207708_10031164 3300026075 Bacteria 4046
107 Ga0207641_10002612 3300026088 Bacteria 16524
108 Ga0207676_10008874 3300026095 Bacteria 7151
109 Ga0207674_10313349 3300026116 Bacteria 1518
110 Ga0207675_100013317 3300026118 Bacteria 7676
111 Ga0209969_1001234 3300027360 Bacteria 3526
112 Ga0209981_1002079 3300027378 Bacteria 2553
113 Ga0210000_1000244 3300027462 Bacteria 7725
114 Ga0209968_1002186 3300027526 Bacteria 2961
115 Ga0209999_1003582 3300027543 Bacteria 2779
116 Ga0207428_10000085 3300027907 Bacteria 132411
117 Ga0207428_10016400 3300027907 Bacteria 6373
118 Ga0207428_10050063 3300027907 Bacteria 3343
119 Ga0307408_100080544 3300031548 Bacteria 2433
120 Ga0307408_100141396 3300031548 Unclassified 1890
121 Ga0265313_10086881 3300031595 Bacteria 1410
122 Ga0307409_100289297 3300031995 Bacteria 1519
123 Ga0307416_100034623 3300032002 Bacteria 3846
124 Ga0307411_10082836 3300032005 Bacteria 2214
125 Ga0373962_0016109 3300035242 Bacteria 1924
126 Ga0316574_0084615 3300035398 Bacteria 2018
127 Ga0316574_0099254 3300035398 Bacteria 1863
128 Ga0373937_0219876 3300036401 Bacteria 1788
129 Ga0400489_76706 3300039093 Unclassified 1660
130 Ga0439461_0009014 3300041410 Bacteria 1802
131 Ga0439446_0003264 3300042156 Bacteria 4005
132 Ga0439434_0009525 3300042435 Bacteria 2857
133 Ga0451577_0028930 3300042876 Bacteria 5011
134 Ga0451577_0049619 3300042876 Bacteria 3747
135 Ga0453684_0013021 3300044712 Bacteria 13583
136 Ga0453684_0094219 3300044712 Bacteria 3684
137 Ga0451576_0000839 3300045051 Bacteria 59904
138 Ga0495621_0011167 3300046539 Bacteria 2770
139 Ga0496102_0029221 3300048905 Bacteria 4931
140 Ga0496104_0019480 3300048907 Bacteria 6209
141 Ga0496108_0021140 3300048911 Bacteria 5347
142 Ga0496109_0002186 3300048912 Bacteria 16231
143 Ga0496110_0003018 3300048913 Bacteria 12773
144 Ga0496110_0098702 3300048913 Bacteria 2618
145 Ga0496111_0010914 3300048914 Bacteria 6111
146 Ga0501036_0026862 3300049572 Bacteria 4864
147 Ga0501036_0282005 3300049572 Bacteria 1390
148 Ga0501039_0087558 3300049575 Bacteria 2426
149 Ga0501039_0104361 3300049575 Bacteria 2213
150 Ga0501040_0034811 3300049576 Bacteria 3412
151 Ga0501071_0006388 3300049587 Bacteria 7651
152 Ga0501071_0012294 3300049587 Bacteria 5801
153 Ga0501072_0107106 3300049588 Bacteria 2223
154 Ga0501072_0131590 3300049588 Bacteria 1994
155 Ga0501074_0213232 3300049590 Bacteria 1375
156 Ga0501075_0036950 3300049591 Bacteria 3646
157 Ga0501075_0237645 3300049591 Bacteria 1389
158 Ga0501076_0001198 3300049592 Bacteria 17207
159 Ga0501076_0007888 3300049592 Bacteria 7762
160 Ga0501079_0152562 3300049741 Bacteria 1801
161 Ga0501045_0018321 3300049824 Bacteria 4980
162 nmdc:mga00v17_54618_c1 3300050491 Bacteria 2437
163 nmdc:mga0k408_1676_c1 3300050493 Bacteria 11958
164 nmdc:mga06z11_8553_c1 3300050494 Bacteria 4278
165 nmdc:mga05p37_21793_c1 3300050507 Bacteria 7762
166 nmdc:mga05p37_260010_c1 3300050507 Bacteria 2078
167 nmdc:mga05p37_30101_c1 3300050507 Bacteria 6624
168 nmdc:mga05p37_335613_c1 3300050507 Bacteria 1784
169 nmdc:mga05p37_38793_c1 3300050507 Bacteria 5845
170 nmdc:mga05p37_74905_c1 3300050507 Bacteria 4166
171 nmdc:mga05p37_77392_c1 3300050507 Bacteria 4095
172 nmdc:mga05p37_77745_c1 3300050507 Bacteria 4085
173 nmdc:mga09592_262516_c1 3300050508 Unclassified 1498
174 nmdc:mga09592_293369_c1 3300050508 Unclassified 1410
175 nmdc:mga0qj67_28825_c1 3300050509 Bacteria 4311
176 nmdc:mga06r32_142181_c1 3300050510 Bacteria 2377
177 nmdc:mga06r32_173877_c1 3300050510 Bacteria 2138
178 nmdc:mga06r32_22838_c1 3300050510 Bacteria 5786
179 nmdc:mga08y16_105022_c1 3300050511 Bacteria 2941
180 nmdc:mga08y16_151274_c1 3300050511 Bacteria 2412
181 nmdc:mga08y16_22973_c1 3300050511 Bacteria 6584
182 nmdc:mga08y16_23723_c1 3300050511 Bacteria 6477
183 nmdc:mga08y16_2884_c1 3300050511 Bacteria 17692
184 nmdc:mga08y16_3468_c1 3300050511 Bacteria 16370
185 nmdc:mga08y16_77349_c1 3300050511 Bacteria 3469
186 nmdc:mga0n895_238299_c1 3300050512 Bacteria 1846
187 nmdc:mga0n895_243672_c1 3300050512 Bacteria 1824
188 nmdc:mga0a205_238805_c1 3300050515 Bacteria 1698
189 Ga0501084_0073352 3300054114 Bacteria 2866
190 Ga0501084_0133386 3300054114 Bacteria 2091
191 Ga0590071_004641 3300059421 Bacteria 3323
192 2919500272 2919497567 Bacteria 4408621
193 Ga0451577_0118579
194 JGI24751J29686_10000924
195 Ga0065712_10075349
196 Ga0065712_10075394
197 Ga0065715_10007153
198 Ga0065715_10118781
199 Ga0065707_10143735
200 Ga0070683_100003797
201 Ga0068869_100019368
202 Ga0070680_100101038
203 Ga0070660_100233520
204 Ga0070689_100134286
205 Ga0070661_100008910
206 Ga0070668_100320947
207 Ga0070669_100077736
208 Ga0070671_100018437
209 Ga0070674_100010094
210 Ga0070659_100021883
211 Ga0070694_100052153
212 Ga0070681_10008229
213 Ga0070698_100116148
214 Ga0070679_100094947
215 Ga0070684_100000897
216 Ga0070672_100066703
217 Ga0070696_100212979
218 Ga0070693_100018764
219 Ga0070665_100366029
220 Ga0070704_100016185
221 Ga0070704_100154673
222 Ga0070664_100003663
223 Ga0068859_100052212
224 Ga0068859_100370769
225 Ga0068864_100019868
226 Ga0068861_100089600
227 Ga0068863_100002664
228 Ga0068863_100086008
229 Ga0068858_100028570
230 Ga0068858_100112801
231 Ga0068860_100161590
232 Ga0068862_100161889
233 Ga0081455_10065637
234 Ga0075368_10015549
235 Ga0075363_100057537
236 Ga0075367_10000639
237 Ga0075367_10004903
238 Ga0075366_10028923
239 Ga0075366_10032118
240 Ga0068871_100136733
241 Ga0075428_100057392
242 Ga0075428_100073464
243 Ga0075428_100145856
244 Ga0075430_100091331
245 Ga0075430_100183606
246 Ga0075431_100008888
247 Ga0075431_100026960
248 Ga0075431_100051952
249 Ga0075431_100072437
250 Ga0075433_10065769
251 Ga0075434_100123618
252 Ga0075429_100108352
253 Ga0075429_100110832
254 Ga0075429_100128902
255 Ga0097620_100052212
256 Ga0111539_10001388
257 Ga0111539_10001947
258 Ga0111539_10046369
259 Ga0111539_10046460
260 Ga0111539_10071583
261 Ga0111539_10090540
262 Ga0111539_10179524
263 Ga0114129_10007438
264 Ga0114129_10053442
265 Ga0114129_10072839
266 Ga0114129_10091626
267 Ga0114129_10127178
268 Ga0114129_10162603
269 Ga0114129_10169208
270 Ga0114129_10485541
271 Ga0105248_10019606
272 Ga0105248_10035645
273 Ga0105248_10393253
274 Ga0163162_10103027
275 Ga0163163_10019026
276 Ga0163163_10244642
277 Ga0157380_10020151
278 Ga0157380_10026251
279 Ga0157380_10029546
280 Ga0157379_10061661
281 Ga0157379_10178160
282 Ga0207707_10007024
283 Ga0207660_10086193
284 Ga0207649_10022329
285 Ga0207652_10245007
286 Ga0207650_10153846
287 Ga0207690_10057202
288 Ga0207706_10150757
289 Ga0207706_10194039
290 Ga0207669_10091972
291 Ga0207711_10173131
292 Ga0207661_10079921
293 Ga0207679_10106127
294 Ga0207712_10215860
295 Ga0207668_10255396
296 Ga0207640_10136563
297 Ga0207703_10092470
298 Ga0207708_10031164
299 Ga0207641_10002612
300 Ga0207676_10008874
301 Ga0207674_10313349
302 Ga0207675_100013317
303 Ga0209969_1001234
304 Ga0209981_1002079
305 Ga0210000_1000244
306 Ga0209968_1002186
307 Ga0209999_1003582
308 Ga0207428_10000085
309 Ga0207428_10016400
310 Ga0207428_10050063
311 Ga0307408_100080544
312 Ga0307408_100141396
313 Ga0265313_10086881
314 Ga0307409_100289297
315 Ga0307416_100034623
316 Ga0307411_10082836
317 Ga0373962_0016109
318 Ga0316574_0084615
319 Ga0316574_0099254
320 Ga0373937_0219876
321 Ga0400489_76706
322 Ga0439461_0009014
323 Ga0439446_0003264
324 Ga0439434_0009525
325 Ga0451577_0028930
326 Ga0451577_0049619
327 Ga0453684_0013021
328 Ga0453684_0094219
329 Ga0451576_0000839
330 Ga0495621_0011167
331 Ga0496102_0029221
332 Ga0496104_0019480
333 Ga0496108_0021140
334 Ga0496109_0002186
335 Ga0496110_0003018
336 Ga0496110_0098702
337 Ga0496111_0010914
338 Ga0501036_0026862
339 Ga0501036_0282005
340 Ga0501039_0087558
341 Ga0501039_0104361
342 Ga0501040_0034811
343 Ga0501071_0006388
344 Ga0501071_0012294
345 Ga0501072_0107106
346 Ga0501072_0131590
347 Ga0501074_0213232
348 Ga0501075_0036950
349 Ga0501075_0237645
350 Ga0501076_0001198
351 Ga0501076_0007888
352 Ga0501079_0152562
353 Ga0501045_0018321
354 nmdc:mga00v17_54618_c1
355 nmdc:mga0k408_1676_c1
356 nmdc:mga06z11_8553_c1
357 nmdc:mga05p37_21793_c1
358 nmdc:mga05p37_260010_c1
359 nmdc:mga05p37_30101_c1
360 nmdc:mga05p37_335613_c1
361 nmdc:mga05p37_38793_c1
362 nmdc:mga05p37_74905_c1
363 nmdc:mga05p37_77392_c1
364 nmdc:mga05p37_77745_c1
365 nmdc:mga09592_262516_c1
366 nmdc:mga09592_293369_c1
367 nmdc:mga0qj67_28825_c1
368 nmdc:mga06r32_142181_c1
369 nmdc:mga06r32_173877_c1
370 nmdc:mga06r32_22838_c1
371 nmdc:mga08y16_105022_c1
372 nmdc:mga08y16_151274_c1
373 nmdc:mga08y16_22973_c1
374 nmdc:mga08y16_23723_c1
375 nmdc:mga08y16_2884_c1
376 nmdc:mga08y16_3468_c1
377 nmdc:mga08y16_77349_c1
378 nmdc:mga0n895_238299_c1
379 nmdc:mga0n895_243672_c1
380 nmdc:mga0a205_238805_c1
381 Ga0501084_0073352
382 Ga0501084_0133386
383 Ga0590071_004641
384 2919500272

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

284

418

0.93

PF12704

MacB_PCD

MacB-like periplasmic core domain

25

255

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.9282 29 233
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8975 30 233
5udf-assembly1.cif.gz_C structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8955 29 233
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8835 29 233
5udf-assembly1.cif.gz_C structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8663 29 233
ID Description Score Start End Superfamily
af_A0A1X7YEN0_151_261_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.5382 27 71 3.30.70.330
af_Q940N9_65_224_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4989 250 383 1.20.1250.20
af_Q9VI20_28_168_3.50.30.30 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.4735 183 209 3.50.30.30
3s6xA04 Mainly Beta;Sandwich;Adenovirus Type 5 Fiber Protein (Receptor Binding Domain);Virus attachment protein , globular domain 0.4468 67 91 2.60.90.20
af_O44196_293_482_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4461 239 382 1.10.357.20
ID Description Score Start End GO Terms
AF-A0A2V8SXE7-F1-model_v4 ABC3 transporter permease C-terminal domain-containing protein 0.9162 257 385 GO:0044874
GO:0098797
AF-A0A2V8SXE7-F1-model_v4 ABC3 transporter permease C-terminal domain-containing protein 0.9031 257 385 GO:0044874
GO:0098797
AF-A0A7V7FKS1-F1-model_v4 FtsX-like permease family protein 0.8957 231 385 GO:0044874
GO:0098797
AF-U2WUS0-F1-model_v4 Putative competence protein ComEC-Rec2 0.8868 27 385 GO:0042953
GO:0044874
GO:0098797
AF-A0A349S498-F1-model_v4 Lipoprotein-releasing system transmembrane subunit LolC 0.875 124 385 GO:0044874
GO:0098797

Map