F295825
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 192 | 93 | 384 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300028556|Ga0265337_1000076|Ga0265337_100007620 |
| Length | 330 |
| Sequence | MRSSEYLRISRPSVCDARVFTWAAGGDCLKGEPDPMSLAVHRPPLLVADRWRDYQLIDCGEGMKQERWGPYTLVRPDPQVLWPRQGTEPGARWEHWDGFYHRSDAGGGRWEFRRPLPEHWEIRYDALGLTFKIRPTSFKHTGLFPEQAVNWDWIDTRVRTAGRPVGVLNLFGYTGAATCAAACHVDAAEGMVKWCKENAALSGLADKPIRYIADDCLKFVRREVKRGRRYDAVIMDPPTYGRGSTGELWRLEDHLWELLQECRTLLSDKPLFFLVNAYTARLSPTVVANLLSQLLRDLPGKISAGEVGLPVQRDGKVLPCGIYGRWEAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 9 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 11 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 13 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 15 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 16 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 17 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 19 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 20 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 30 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 31 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 32 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 33 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 34 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 35 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 36 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 37 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 38 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 39 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 40 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 41 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 42 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 43 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 44 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 45 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 46 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 47 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 48 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 49 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 50 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 51 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 52 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 53 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 54 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 55 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 56 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 57 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 58 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 59 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 60 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 61 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 62 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 63 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 64 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 65 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 66 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 67 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 68 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 69 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 70 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 71 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 72 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 73 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 74 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 75 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 76 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 77 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 78 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 79 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 80 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 81 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 82 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 83 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 84 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 85 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 86 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 87 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 88 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 89 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 90 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 91 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 92 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 93 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.44 |
| Metatranscriptomes | 0 |
| Isolates | 1.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.12 |
| Nodule | 0 |
| Rhizoplane | 0.52 |
| Rhizosphere | 88.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265337_1000076 | 3300028556 | Bacteria | 46580 |
| 2 | rootH2_10035167 | 3300003320 | Bacteria | 7348 |
| 3 | rootH2_10070215 | 3300003320 | Bacteria | 7305 |
| 4 | rootH2_10101484 | 3300003320 | Bacteria | 2496 |
| 5 | rootL2_10046851 | 3300003322 | Bacteria | 5452 |
| 6 | rootL2_10192618 | 3300003322 | Bacteria | 2069 |
| 7 | rootH1_10011846 | 3300003323 | Bacteria | 6115 |
| 8 | Ga0070658_10034069 | 3300005327 | Bacteria | 4097 |
| 9 | Ga0070683_100227342 | 3300005329 | Bacteria | 1773 |
| 10 | Ga0068869_100020496 | 3300005334 | Bacteria | 4533 |
| 11 | Ga0068867_100049140 | 3300005459 | Bacteria | 3105 |
| 12 | Ga0070679_100009933 | 3300005530 | Bacteria | 9009 |
| 13 | Ga0070679_100334873 | 3300005530 | Bacteria | 1462 |
| 14 | Ga0068853_100487692 | 3300005539 | Unclassified | 1162 |
| 15 | Ga0070665_100505679 | 3300005548 | Bacteria | 1220 |
| 16 | Ga0068856_100019616 | 3300005614 | Bacteria | 6563 |
| 17 | Ga0068856_100116177 | 3300005614 | Unclassified | 2676 |
| 18 | Ga0070717_10000030 | 3300006028 | Bacteria | 142934 |
| 19 | Ga0070717_10157726 | 3300006028 | Unclassified | 1967 |
| 20 | Ga0097621_100001673 | 3300006237 | Bacteria | 15167 |
| 21 | Ga0068871_100006057 | 3300006358 | Bacteria | 8508 |
| 22 | Ga0068865_100010603 | 3300006881 | Bacteria | 5743 |
| 23 | Ga0105240_10373355 | 3300009093 | Bacteria | 1612 |
| 24 | Ga0209676_1001401 | 3300025292 | Bacteria | 23328 |
| 25 | Ga0209050_1027820 | 3300025298 | Bacteria | 1851 |
| 26 | Ga0207705_10116784 | 3300025909 | Unclassified | 1976 |
| 27 | Ga0207652_10035893 | 3300025921 | Bacteria | 4188 |
| 28 | Ga0207704_10071269 | 3300025938 | Bacteria | 2205 |
| 29 | Ga0207689_10000211 | 3300025942 | Bacteria | 51556 |
| 30 | Ga0207661_10006575 | 3300025944 | Bacteria | 8220 |
| 31 | Ga0207677_10177562 | 3300026023 | Bacteria | 1672 |
| 32 | Ga0207702_10029977 | 3300026078 | Bacteria | 4531 |
| 33 | Ga0207702_10089726 | 3300026078 | Unclassified | 2688 |
| 34 | Ga0207648_10063376 | 3300026089 | Bacteria | 3222 |
| 35 | Ga0207683_10254186 | 3300026121 | Bacteria | 1604 |
| 36 | Ga0265337_1004160 | 3300028556 | Bacteria | 6071 |
| 37 | Ga0265319_1000040 | 3300028563 | Bacteria | 112246 |
| 38 | Ga0265319_1001547 | 3300028563 | Bacteria | 13588 |
| 39 | Ga0265319_1001742 | 3300028563 | Bacteria | 12529 |
| 40 | Ga0265319_1003334 | 3300028563 | Bacteria | 8436 |
| 41 | Ga0265319_1006206 | 3300028563 | Bacteria | 5569 |
| 42 | Ga0265334_10006629 | 3300028573 | Bacteria | 4977 |
| 43 | Ga0265334_10051454 | 3300028573 | Bacteria | 1579 |
| 44 | Ga0265318_10000032 | 3300028577 | Bacteria | 143847 |
| 45 | Ga0265318_10000844 | 3300028577 | Bacteria | 20145 |
| 46 | Ga0265318_10001552 | 3300028577 | Bacteria | 13366 |
| 47 | Ga0265318_10002823 | 3300028577 | Bacteria | 9065 |
| 48 | Ga0265318_10006306 | 3300028577 | Bacteria | 5477 |
| 49 | Ga0265318_10035377 | 3300028577 | Bacteria | 1921 |
| 50 | Ga0265323_10000064 | 3300028653 | Bacteria | 57250 |
| 51 | Ga0265323_10009440 | 3300028653 | Bacteria | 3985 |
| 52 | Ga0265323_10014551 | 3300028653 | Bacteria | 3112 |
| 53 | Ga0265323_10032735 | 3300028653 | Bacteria | 1927 |
| 54 | Ga0265323_10053557 | 3300028653 | Bacteria | 1424 |
| 55 | Ga0265322_10000649 | 3300028654 | Bacteria | 13069 |
| 56 | Ga0265322_10001605 | 3300028654 | Bacteria | 7235 |
| 57 | Ga0265322_10020132 | 3300028654 | Bacteria | 1912 |
| 58 | Ga0265336_10012247 | 3300028666 | Bacteria | 2889 |
| 59 | Ga0265336_10012833 | 3300028666 | Bacteria | 2809 |
| 60 | Ga0307515_10000250 | 3300028794 | Bacteria | 133055 |
| 61 | Ga0307515_10070157 | 3300028794 | Unclassified | 4775 |
| 62 | Ga0307515_10079835 | 3300028794 | Bacteria | 4278 |
| 63 | Ga0265338_10000098 | 3300028800 | Bacteria | 159918 |
| 64 | Ga0265338_10000505 | 3300028800 | Bacteria | 69700 |
| 65 | Ga0265338_10007420 | 3300028800 | Bacteria | 13611 |
| 66 | Ga0265338_10047016 | 3300028800 | Bacteria | 3947 |
| 67 | Ga0265324_10000039 | 3300029957 | Bacteria | 118772 |
| 68 | Ga0265330_10042528 | 3300031235 | Bacteria | 2013 |
| 69 | Ga0265328_10041907 | 3300031239 | Bacteria | 1685 |
| 70 | Ga0265320_10000071 | 3300031240 | Bacteria | 89794 |
| 71 | Ga0265320_10000900 | 3300031240 | Bacteria | 22353 |
| 72 | Ga0265320_10008628 | 3300031240 | Bacteria | 6219 |
| 73 | Ga0265320_10013955 | 3300031240 | Bacteria | 4602 |
| 74 | Ga0265320_10016653 | 3300031240 | Bacteria | 4113 |
| 75 | Ga0265320_10017376 | 3300031240 | Bacteria | 3997 |
| 76 | Ga0265320_10019574 | 3300031240 | Bacteria | 3697 |
| 77 | Ga0265320_10058503 | 3300031240 | Bacteria | 1845 |
| 78 | Ga0265325_10018010 | 3300031241 | Bacteria | 3919 |
| 79 | Ga0265325_10023878 | 3300031241 | Bacteria | 3332 |
| 80 | Ga0265340_10021818 | 3300031247 | Unclassified | 3279 |
| 81 | Ga0265331_10001795 | 3300031250 | Bacteria | 15279 |
| 82 | Ga0265327_10000061 | 3300031251 | Bacteria | 234364 |
| 83 | Ga0265327_10000066 | 3300031251 | Bacteria | 221705 |
| 84 | Ga0265327_10001302 | 3300031251 | Bacteria | 32638 |
| 85 | Ga0265327_10001524 | 3300031251 | Bacteria | 28621 |
| 86 | Ga0265327_10005708 | 3300031251 | Bacteria | 10270 |
| 87 | Ga0265316_10001079 | 3300031344 | Bacteria | 29504 |
| 88 | Ga0265316_10027295 | 3300031344 | Bacteria | 4730 |
| 89 | Ga0265316_10031244 | 3300031344 | Bacteria | 4357 |
| 90 | Ga0265316_10032454 | 3300031344 | Bacteria | 4261 |
| 91 | Ga0265316_10033304 | 3300031344 | Bacteria | 4198 |
| 92 | Ga0265316_10147735 | 3300031344 | Bacteria | 1762 |
| 93 | Ga0307513_10429385 | 3300031456 | Bacteria | 1050 |
| 94 | Ga0307408_100000093 | 3300031548 | Bacteria | 98443 |
| 95 | Ga0265313_10000350 | 3300031595 | Bacteria | 50178 |
| 96 | Ga0265313_10001657 | 3300031595 | Bacteria | 20646 |
| 97 | Ga0265313_10006250 | 3300031595 | Bacteria | 8496 |
| 98 | Ga0265313_10006647 | 3300031595 | Bacteria | 8107 |
| 99 | Ga0265313_10010981 | 3300031595 | Bacteria | 5664 |
| 100 | Ga0265313_10016439 | 3300031595 | Bacteria | 4253 |
| 101 | Ga0265313_10024656 | 3300031595 | Unclassified | 3208 |
| 102 | Ga0307508_10000084 | 3300031616 | Bacteria | 111000 |
| 103 | Ga0265314_10000072 | 3300031711 | Bacteria | 149041 |
| 104 | Ga0265314_10001488 | 3300031711 | Bacteria | 26064 |
| 105 | Ga0265314_10003079 | 3300031711 | Bacteria | 16442 |
| 106 | Ga0265314_10009942 | 3300031711 | Bacteria | 7977 |
| 107 | Ga0265314_10029950 | 3300031711 | Bacteria | 4035 |
| 108 | Ga0265314_10118419 | 3300031711 | Bacteria | 1671 |
| 109 | Ga0265314_10185841 | 3300031711 | Bacteria | 1241 |
| 110 | Ga0265342_10010317 | 3300031712 | Bacteria | 6494 |
| 111 | Ga0265342_10017365 | 3300031712 | Bacteria | 4682 |
| 112 | Ga0265342_10017833 | 3300031712 | Bacteria | 4610 |
| 113 | Ga0265342_10035264 | 3300031712 | Unclassified | 3064 |
| 114 | Ga0265342_10036945 | 3300031712 | Bacteria | 2981 |
| 115 | Ga0265342_10052731 | 3300031712 | Bacteria | 2423 |
| 116 | Ga0265342_10154485 | 3300031712 | Bacteria | 1272 |
| 117 | Ga0307410_10000495 | 3300031852 | Bacteria | 16007 |
| 118 | Ga0307409_100000097 | 3300031995 | Bacteria | 31926 |
| 119 | Ga0307416_100000139 | 3300032002 | Bacteria | 42661 |
| 120 | Ga0373951_0026164 | 3300035091 | Bacteria | 1358 |
| 121 | Ga0373942_0022124 | 3300035207 | Bacteria | 1611 |
| 122 | Ga0373935_0089726 | 3300035692 | Bacteria | 2011 |
| 123 | Ga0395905_0000026 | 3300037471 | Bacteria | 315051 |
| 124 | Ga0395905_0643796 | 3300037471 | Bacteria | 962 |
| 125 | Ga0436364_0795555 | 3300037853 | Bacteria | 5775 |
| 126 | Ga0436365_1418877 | 3300039437 | Bacteria | 1868 |
| 127 | Ga0451807_0288258 | 3300041486 | Unclassified | 1036 |
| 128 | Ga0451577_0032358 | 3300042876 | Bacteria | 4712 |
| 129 | Ga0451577_0114886 | 3300042876 | Bacteria | 2410 |
| 130 | Ga0451577_0132004 | 3300042876 | Bacteria | 2241 |
| 131 | Ga0451577_0198121 | 3300042876 | Bacteria | 1813 |
| 132 | Ga0451577_0411596 | 3300042876 | Bacteria | 1227 |
| 133 | Ga0453683_0001810 | 3300044673 | Bacteria | 17659 |
| 134 | Ga0466966_0124498 | 3300044684 | Unclassified | 1581 |
| 135 | Ga0466961_0123282 | 3300044693 | Unclassified | 1626 |
| 136 | Ga0466963_0031017 | 3300044694 | Bacteria | 3453 |
| 137 | Ga0453684_0009998 | 3300044712 | Bacteria | 16346 |
| 138 | Ga0453684_0032456 | 3300044712 | Bacteria | 7308 |
| 139 | Ga0453684_0039898 | 3300044712 | Bacteria | 6386 |
| 140 | Ga0453684_0063707 | 3300044712 | Bacteria | 4713 |
| 141 | Ga0453684_0085172 | 3300044712 | Bacteria | 3928 |
| 142 | Ga0453684_0133888 | 3300044712 | Bacteria | 2970 |
| 143 | Ga0453684_0214230 | 3300044712 | Bacteria | 2236 |
| 144 | Ga0451576_0000052 | 3300045051 | Bacteria | 310414 |
| 145 | Ga0451576_0003063 | 3300045051 | Bacteria | 23511 |
| 146 | Ga0451576_0065217 | 3300045051 | Bacteria | 3792 |
| 147 | Ga0451576_0082059 | 3300045051 | Bacteria | 3353 |
| 148 | Ga0451576_0242153 | 3300045051 | Bacteria | 1884 |
| 149 | Ga0451576_0606969 | 3300045051 | Bacteria | 1150 |
| 150 | Ga0466967_0134390 | 3300045976 | Bacteria | 2299 |
| 151 | Ga0501031_0003703 | 3300049568 | Bacteria | 9832 |
| 152 | Ga0501032_0000568 | 3300049569 | Bacteria | 29936 |
| 153 | Ga0501032_0000961 | 3300049569 | Bacteria | 23289 |
| 154 | Ga0501033_0000873 | 3300049570 | Bacteria | 27545 |
| 155 | Ga0501033_0009203 | 3300049570 | Bacteria | 7606 |
| 156 | Ga0501034_0021175 | 3300049571 | Bacteria | 6632 |
| 157 | Ga0501034_0094319 | 3300049571 | Bacteria | 2989 |
| 158 | Ga0501036_0015830 | 3300049572 | Bacteria | 6297 |
| 159 | Ga0501036_0227316 | 3300049572 | Bacteria | 1566 |
| 160 | Ga0501037_0058946 | 3300049573 | Bacteria | 2801 |
| 161 | Ga0501038_0035451 | 3300049574 | Bacteria | 4380 |
| 162 | Ga0501042_0275470 | 3300049578 | Bacteria | 1215 |
| 163 | Ga0501043_0151017 | 3300049579 | Bacteria | 1818 |
| 164 | Ga0501046_0002902 | 3300049580 | Bacteria | 15895 |
| 165 | Ga0501046_0011249 | 3300049580 | Bacteria | 7661 |
| 166 | Ga0501046_0024506 | 3300049580 | Bacteria | 4947 |
| 167 | Ga0501046_0037858 | 3300049580 | Bacteria | 3874 |
| 168 | Ga0501047_0004280 | 3300049581 | Bacteria | 13438 |
| 169 | Ga0501047_0205781 | 3300049581 | Unclassified | 1827 |
| 170 | Ga0501047_0264951 | 3300049581 | Bacteria | 1565 |
| 171 | Ga0501048_0019523 | 3300049582 | Bacteria | 4971 |
| 172 | Ga0501048_0038902 | 3300049582 | Bacteria | 3413 |
| 173 | Ga0501070_0000233 | 3300049586 | Bacteria | 52695 |
| 174 | Ga0501080_0260894 | 3300049742 | Bacteria | 1579 |
| 175 | Ga0501083_0001211 | 3300049744 | Bacteria | 17470 |
| 176 | Ga0501083_0005604 | 3300049744 | Bacteria | 8888 |
| 177 | Ga0501083_0026920 | 3300049744 | Bacteria | 3972 |
| 178 | Ga0501083_0052376 | 3300049744 | Bacteria | 2742 |
| 179 | Ga0501035_0001152 | 3300049822 | Bacteria | 27641 |
| 180 | Ga0501035_0005817 | 3300049822 | Bacteria | 11623 |
| 181 | Ga0501044_0001466 | 3300049823 | Bacteria | 27696 |
| 182 | Ga0501044_0002018 | 3300049823 | Bacteria | 23414 |
| 183 | Ga0501044_0014307 | 3300049823 | Bacteria | 8564 |
| 184 | Ga0501044_0023002 | 3300049823 | Bacteria | 6633 |
| 185 | Ga0501044_0111810 | 3300049823 | Bacteria | 2739 |
| 186 | Ga0500641_0010389 | 3300053096 | Bacteria | 3363 |
| 187 | Ga0500618_008031 | 3300053125 | Bacteria | 2972 |
| 188 | Ga0500568_0027144 | 3300053139 | Bacteria | 2396 |
| 189 | Ga0500616_0058225 | 3300053153 | Bacteria | 2011 |
| 190 | 2740031465 | 2739367866 | Bacteria | 4215900 |
| 191 | 2788436153 | 2786546940 | Bacteria | 6396474 |
| 192 | 2910249722 | 2910245624 | Bacteria | 6935613 |
| 193 | Ga0265337_1000076 | |||
| 194 | rootH2_10035167 | |||
| 195 | rootH2_10070215 | |||
| 196 | rootH2_10101484 | |||
| 197 | rootL2_10046851 | |||
| 198 | rootL2_10192618 | |||
| 199 | rootH1_10011846 | |||
| 200 | Ga0070658_10034069 | |||
| 201 | Ga0070683_100227342 | |||
| 202 | Ga0068869_100020496 | |||
| 203 | Ga0068867_100049140 | |||
| 204 | Ga0070679_100009933 | |||
| 205 | Ga0070679_100334873 | |||
| 206 | Ga0068853_100487692 | |||
| 207 | Ga0070665_100505679 | |||
| 208 | Ga0068856_100019616 | |||
| 209 | Ga0068856_100116177 | |||
| 210 | Ga0070717_10000030 | |||
| 211 | Ga0070717_10157726 | |||
| 212 | Ga0097621_100001673 | |||
| 213 | Ga0068871_100006057 | |||
| 214 | Ga0068865_100010603 | |||
| 215 | Ga0105240_10373355 | |||
| 216 | Ga0209676_1001401 | |||
| 217 | Ga0209050_1027820 | |||
| 218 | Ga0207705_10116784 | |||
| 219 | Ga0207652_10035893 | |||
| 220 | Ga0207704_10071269 | |||
| 221 | Ga0207689_10000211 | |||
| 222 | Ga0207661_10006575 | |||
| 223 | Ga0207677_10177562 | |||
| 224 | Ga0207702_10029977 | |||
| 225 | Ga0207702_10089726 | |||
| 226 | Ga0207648_10063376 | |||
| 227 | Ga0207683_10254186 | |||
| 228 | Ga0265337_1004160 | |||
| 229 | Ga0265319_1000040 | |||
| 230 | Ga0265319_1001547 | |||
| 231 | Ga0265319_1001742 | |||
| 232 | Ga0265319_1003334 | |||
| 233 | Ga0265319_1006206 | |||
| 234 | Ga0265334_10006629 | |||
| 235 | Ga0265334_10051454 | |||
| 236 | Ga0265318_10000032 | |||
| 237 | Ga0265318_10000844 | |||
| 238 | Ga0265318_10001552 | |||
| 239 | Ga0265318_10002823 | |||
| 240 | Ga0265318_10006306 | |||
| 241 | Ga0265318_10035377 | |||
| 242 | Ga0265323_10000064 | |||
| 243 | Ga0265323_10009440 | |||
| 244 | Ga0265323_10014551 | |||
| 245 | Ga0265323_10032735 | |||
| 246 | Ga0265323_10053557 | |||
| 247 | Ga0265322_10000649 | |||
| 248 | Ga0265322_10001605 | |||
| 249 | Ga0265322_10020132 | |||
| 250 | Ga0265336_10012247 | |||
| 251 | Ga0265336_10012833 | |||
| 252 | Ga0307515_10000250 | |||
| 253 | Ga0307515_10070157 | |||
| 254 | Ga0307515_10079835 | |||
| 255 | Ga0265338_10000098 | |||
| 256 | Ga0265338_10000505 | |||
| 257 | Ga0265338_10007420 | |||
| 258 | Ga0265338_10047016 | |||
| 259 | Ga0265324_10000039 | |||
| 260 | Ga0265330_10042528 | |||
| 261 | Ga0265328_10041907 | |||
| 262 | Ga0265320_10000071 | |||
| 263 | Ga0265320_10000900 | |||
| 264 | Ga0265320_10008628 | |||
| 265 | Ga0265320_10013955 | |||
| 266 | Ga0265320_10016653 | |||
| 267 | Ga0265320_10017376 | |||
| 268 | Ga0265320_10019574 | |||
| 269 | Ga0265320_10058503 | |||
| 270 | Ga0265325_10018010 | |||
| 271 | Ga0265325_10023878 | |||
| 272 | Ga0265340_10021818 | |||
| 273 | Ga0265331_10001795 | |||
| 274 | Ga0265327_10000061 | |||
| 275 | Ga0265327_10000066 | |||
| 276 | Ga0265327_10001302 | |||
| 277 | Ga0265327_10001524 | |||
| 278 | Ga0265327_10005708 | |||
| 279 | Ga0265316_10001079 | |||
| 280 | Ga0265316_10027295 | |||
| 281 | Ga0265316_10031244 | |||
| 282 | Ga0265316_10032454 | |||
| 283 | Ga0265316_10033304 | |||
| 284 | Ga0265316_10147735 | |||
| 285 | Ga0307513_10429385 | |||
| 286 | Ga0307408_100000093 | |||
| 287 | Ga0265313_10000350 | |||
| 288 | Ga0265313_10001657 | |||
| 289 | Ga0265313_10006250 | |||
| 290 | Ga0265313_10006647 | |||
| 291 | Ga0265313_10010981 | |||
| 292 | Ga0265313_10016439 | |||
| 293 | Ga0265313_10024656 | |||
| 294 | Ga0307508_10000084 | |||
| 295 | Ga0265314_10000072 | |||
| 296 | Ga0265314_10001488 | |||
| 297 | Ga0265314_10003079 | |||
| 298 | Ga0265314_10009942 | |||
| 299 | Ga0265314_10029950 | |||
| 300 | Ga0265314_10118419 | |||
| 301 | Ga0265314_10185841 | |||
| 302 | Ga0265342_10010317 | |||
| 303 | Ga0265342_10017365 | |||
| 304 | Ga0265342_10017833 | |||
| 305 | Ga0265342_10035264 | |||
| 306 | Ga0265342_10036945 | |||
| 307 | Ga0265342_10052731 | |||
| 308 | Ga0265342_10154485 | |||
| 309 | Ga0307410_10000495 | |||
| 310 | Ga0307409_100000097 | |||
| 311 | Ga0307416_100000139 | |||
| 312 | Ga0373951_0026164 | |||
| 313 | Ga0373942_0022124 | |||
| 314 | Ga0373935_0089726 | |||
| 315 | Ga0395905_0000026 | |||
| 316 | Ga0395905_0643796 | |||
| 317 | Ga0436364_0795555 | |||
| 318 | Ga0436365_1418877 | |||
| 319 | Ga0451807_0288258 | |||
| 320 | Ga0451577_0032358 | |||
| 321 | Ga0451577_0114886 | |||
| 322 | Ga0451577_0132004 | |||
| 323 | Ga0451577_0198121 | |||
| 324 | Ga0451577_0411596 | |||
| 325 | Ga0453683_0001810 | |||
| 326 | Ga0466966_0124498 | |||
| 327 | Ga0466961_0123282 | |||
| 328 | Ga0466963_0031017 | |||
| 329 | Ga0453684_0009998 | |||
| 330 | Ga0453684_0032456 | |||
| 331 | Ga0453684_0039898 | |||
| 332 | Ga0453684_0063707 | |||
| 333 | Ga0453684_0085172 | |||
| 334 | Ga0453684_0133888 | |||
| 335 | Ga0453684_0214230 | |||
| 336 | Ga0451576_0000052 | |||
| 337 | Ga0451576_0003063 | |||
| 338 | Ga0451576_0065217 | |||
| 339 | Ga0451576_0082059 | |||
| 340 | Ga0451576_0242153 | |||
| 341 | Ga0451576_0606969 | |||
| 342 | Ga0466967_0134390 | |||
| 343 | Ga0501031_0003703 | |||
| 344 | Ga0501032_0000568 | |||
| 345 | Ga0501032_0000961 | |||
| 346 | Ga0501033_0000873 | |||
| 347 | Ga0501033_0009203 | |||
| 348 | Ga0501034_0021175 | |||
| 349 | Ga0501034_0094319 | |||
| 350 | Ga0501036_0015830 | |||
| 351 | Ga0501036_0227316 | |||
| 352 | Ga0501037_0058946 | |||
| 353 | Ga0501038_0035451 | |||
| 354 | Ga0501042_0275470 | |||
| 355 | Ga0501043_0151017 | |||
| 356 | Ga0501046_0002902 | |||
| 357 | Ga0501046_0011249 | |||
| 358 | Ga0501046_0024506 | |||
| 359 | Ga0501046_0037858 | |||
| 360 | Ga0501047_0004280 | |||
| 361 | Ga0501047_0205781 | |||
| 362 | Ga0501047_0264951 | |||
| 363 | Ga0501048_0019523 | |||
| 364 | Ga0501048_0038902 | |||
| 365 | Ga0501070_0000233 | |||
| 366 | Ga0501080_0260894 | |||
| 367 | Ga0501083_0001211 | |||
| 368 | Ga0501083_0005604 | |||
| 369 | Ga0501083_0026920 | |||
| 370 | Ga0501083_0052376 | |||
| 371 | Ga0501035_0001152 | |||
| 372 | Ga0501035_0005817 | |||
| 373 | Ga0501044_0001466 | |||
| 374 | Ga0501044_0002018 | |||
| 375 | Ga0501044_0014307 | |||
| 376 | Ga0501044_0023002 | |||
| 377 | Ga0501044_0111810 | |||
| 378 | Ga0500641_0010389 | |||
| 379 | Ga0500618_008031 | |||
| 380 | Ga0500568_0027144 | |||
| 381 | Ga0500616_0058225 | |||
| 382 | 2740031465 | |||
| 383 | 2788436153 | |||
| 384 | 2910249722 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2igt-assembly1.cif.gz_C | crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens | 0.9422 | 6 | 296 |
| 2igt-assembly1.cif.gz_A | crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens | 0.9395 | 6 | 296 |
| 2igt-assembly1.cif.gz_C | crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens | 0.9237 | 6 | 296 |
| 2igt-assembly1.cif.gz_A | crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens | 0.9211 | 6 | 296 |
| 2igt-assembly1.cif.gz_B | crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens | 0.9085 | 1 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2igtC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9173 | 75 | 296 | 3.40.50.150 |
| af_Q557I0_186_398_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8638 | 80 | 258 | 3.40.50.150 |
| 2igtC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8293 | 75 | 296 | 3.40.50.150 |
| 2igtB02 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.8161 | 15 | 77 | 2.60.40.1180 |
| 1ws6A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.813 | 104 | 251 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0EBL7-F1-model_v4 | deleted | 0.9798 | 124 | 295 |
|
| AF-A0A354TXF4-F1-model_v4 | deleted | 0.9794 | 175 | 295 |
|
| AF-A0A7U9RVI4-F1-model_v4 | Ribosomal RNA large subunit methyltransferase K/L (EC 2.1.1.264) | 0.9776 | 142 | 296 |
GO:0008168
GO:0032259 |
| AF-A0A3D4JEI0-F1-model_v4 | SAM-dependent methyltransferase | 0.9772 | 97 | 296 |
GO:0008168
GO:0032259 |
| AF-A0A356W6V2-F1-model_v4 | SAM-dependent methyltransferase | 0.9763 | 197 | 295 |
GO:0008168
GO:0032259 |