F295825

General Info

Members Datasets Scaffolds Average Seq Length
192 93 384 300

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1000076|Ga0265337_100007620
Length 330
Sequence MRSSEYLRISRPSVCDARVFTWAAGGDCLKGEPDPMSLAVHRPPLLVADRWRDYQLIDCGEGMKQERWGPYTLVRPDPQVLWPRQGTEPGARWEHWDGFYHRSDAGGGRWEFRRPLPEHWEIRYDALGLTFKIRPTSFKHTGLFPEQAVNWDWIDTRVRTAGRPVGVLNLFGYTGAATCAAACHVDAAEGMVKWCKENAALSGLADKPIRYIADDCLKFVRREVKRGRRYDAVIMDPPTYGRGSTGELWRLEDHLWELLQECRTLLSDKPLFFLVNAYTARLSPTVVANLLSQLLRDLPGKISAGEVGLPVQRDGKVLPCGIYGRWEAAG

Samples

Sample ID Description Type Environment
1 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
16 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
30 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
31 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
32 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
33 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
34 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
35 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
36 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
37 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
38 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
39 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
40 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
41 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
42 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
43 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
46 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
56 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
57 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
85 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
87 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
88 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
89 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
90 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
91 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
92 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
93 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.44
Metatranscriptomes 0
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 0.52
Rhizosphere 88.54
Stem 0
Stem Tuber 0
Unclassified 6.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265337_1000076 3300028556 Bacteria 46580
2 rootH2_10035167 3300003320 Bacteria 7348
3 rootH2_10070215 3300003320 Bacteria 7305
4 rootH2_10101484 3300003320 Bacteria 2496
5 rootL2_10046851 3300003322 Bacteria 5452
6 rootL2_10192618 3300003322 Bacteria 2069
7 rootH1_10011846 3300003323 Bacteria 6115
8 Ga0070658_10034069 3300005327 Bacteria 4097
9 Ga0070683_100227342 3300005329 Bacteria 1773
10 Ga0068869_100020496 3300005334 Bacteria 4533
11 Ga0068867_100049140 3300005459 Bacteria 3105
12 Ga0070679_100009933 3300005530 Bacteria 9009
13 Ga0070679_100334873 3300005530 Bacteria 1462
14 Ga0068853_100487692 3300005539 Unclassified 1162
15 Ga0070665_100505679 3300005548 Bacteria 1220
16 Ga0068856_100019616 3300005614 Bacteria 6563
17 Ga0068856_100116177 3300005614 Unclassified 2676
18 Ga0070717_10000030 3300006028 Bacteria 142934
19 Ga0070717_10157726 3300006028 Unclassified 1967
20 Ga0097621_100001673 3300006237 Bacteria 15167
21 Ga0068871_100006057 3300006358 Bacteria 8508
22 Ga0068865_100010603 3300006881 Bacteria 5743
23 Ga0105240_10373355 3300009093 Bacteria 1612
24 Ga0209676_1001401 3300025292 Bacteria 23328
25 Ga0209050_1027820 3300025298 Bacteria 1851
26 Ga0207705_10116784 3300025909 Unclassified 1976
27 Ga0207652_10035893 3300025921 Bacteria 4188
28 Ga0207704_10071269 3300025938 Bacteria 2205
29 Ga0207689_10000211 3300025942 Bacteria 51556
30 Ga0207661_10006575 3300025944 Bacteria 8220
31 Ga0207677_10177562 3300026023 Bacteria 1672
32 Ga0207702_10029977 3300026078 Bacteria 4531
33 Ga0207702_10089726 3300026078 Unclassified 2688
34 Ga0207648_10063376 3300026089 Bacteria 3222
35 Ga0207683_10254186 3300026121 Bacteria 1604
36 Ga0265337_1004160 3300028556 Bacteria 6071
37 Ga0265319_1000040 3300028563 Bacteria 112246
38 Ga0265319_1001547 3300028563 Bacteria 13588
39 Ga0265319_1001742 3300028563 Bacteria 12529
40 Ga0265319_1003334 3300028563 Bacteria 8436
41 Ga0265319_1006206 3300028563 Bacteria 5569
42 Ga0265334_10006629 3300028573 Bacteria 4977
43 Ga0265334_10051454 3300028573 Bacteria 1579
44 Ga0265318_10000032 3300028577 Bacteria 143847
45 Ga0265318_10000844 3300028577 Bacteria 20145
46 Ga0265318_10001552 3300028577 Bacteria 13366
47 Ga0265318_10002823 3300028577 Bacteria 9065
48 Ga0265318_10006306 3300028577 Bacteria 5477
49 Ga0265318_10035377 3300028577 Bacteria 1921
50 Ga0265323_10000064 3300028653 Bacteria 57250
51 Ga0265323_10009440 3300028653 Bacteria 3985
52 Ga0265323_10014551 3300028653 Bacteria 3112
53 Ga0265323_10032735 3300028653 Bacteria 1927
54 Ga0265323_10053557 3300028653 Bacteria 1424
55 Ga0265322_10000649 3300028654 Bacteria 13069
56 Ga0265322_10001605 3300028654 Bacteria 7235
57 Ga0265322_10020132 3300028654 Bacteria 1912
58 Ga0265336_10012247 3300028666 Bacteria 2889
59 Ga0265336_10012833 3300028666 Bacteria 2809
60 Ga0307515_10000250 3300028794 Bacteria 133055
61 Ga0307515_10070157 3300028794 Unclassified 4775
62 Ga0307515_10079835 3300028794 Bacteria 4278
63 Ga0265338_10000098 3300028800 Bacteria 159918
64 Ga0265338_10000505 3300028800 Bacteria 69700
65 Ga0265338_10007420 3300028800 Bacteria 13611
66 Ga0265338_10047016 3300028800 Bacteria 3947
67 Ga0265324_10000039 3300029957 Bacteria 118772
68 Ga0265330_10042528 3300031235 Bacteria 2013
69 Ga0265328_10041907 3300031239 Bacteria 1685
70 Ga0265320_10000071 3300031240 Bacteria 89794
71 Ga0265320_10000900 3300031240 Bacteria 22353
72 Ga0265320_10008628 3300031240 Bacteria 6219
73 Ga0265320_10013955 3300031240 Bacteria 4602
74 Ga0265320_10016653 3300031240 Bacteria 4113
75 Ga0265320_10017376 3300031240 Bacteria 3997
76 Ga0265320_10019574 3300031240 Bacteria 3697
77 Ga0265320_10058503 3300031240 Bacteria 1845
78 Ga0265325_10018010 3300031241 Bacteria 3919
79 Ga0265325_10023878 3300031241 Bacteria 3332
80 Ga0265340_10021818 3300031247 Unclassified 3279
81 Ga0265331_10001795 3300031250 Bacteria 15279
82 Ga0265327_10000061 3300031251 Bacteria 234364
83 Ga0265327_10000066 3300031251 Bacteria 221705
84 Ga0265327_10001302 3300031251 Bacteria 32638
85 Ga0265327_10001524 3300031251 Bacteria 28621
86 Ga0265327_10005708 3300031251 Bacteria 10270
87 Ga0265316_10001079 3300031344 Bacteria 29504
88 Ga0265316_10027295 3300031344 Bacteria 4730
89 Ga0265316_10031244 3300031344 Bacteria 4357
90 Ga0265316_10032454 3300031344 Bacteria 4261
91 Ga0265316_10033304 3300031344 Bacteria 4198
92 Ga0265316_10147735 3300031344 Bacteria 1762
93 Ga0307513_10429385 3300031456 Bacteria 1050
94 Ga0307408_100000093 3300031548 Bacteria 98443
95 Ga0265313_10000350 3300031595 Bacteria 50178
96 Ga0265313_10001657 3300031595 Bacteria 20646
97 Ga0265313_10006250 3300031595 Bacteria 8496
98 Ga0265313_10006647 3300031595 Bacteria 8107
99 Ga0265313_10010981 3300031595 Bacteria 5664
100 Ga0265313_10016439 3300031595 Bacteria 4253
101 Ga0265313_10024656 3300031595 Unclassified 3208
102 Ga0307508_10000084 3300031616 Bacteria 111000
103 Ga0265314_10000072 3300031711 Bacteria 149041
104 Ga0265314_10001488 3300031711 Bacteria 26064
105 Ga0265314_10003079 3300031711 Bacteria 16442
106 Ga0265314_10009942 3300031711 Bacteria 7977
107 Ga0265314_10029950 3300031711 Bacteria 4035
108 Ga0265314_10118419 3300031711 Bacteria 1671
109 Ga0265314_10185841 3300031711 Bacteria 1241
110 Ga0265342_10010317 3300031712 Bacteria 6494
111 Ga0265342_10017365 3300031712 Bacteria 4682
112 Ga0265342_10017833 3300031712 Bacteria 4610
113 Ga0265342_10035264 3300031712 Unclassified 3064
114 Ga0265342_10036945 3300031712 Bacteria 2981
115 Ga0265342_10052731 3300031712 Bacteria 2423
116 Ga0265342_10154485 3300031712 Bacteria 1272
117 Ga0307410_10000495 3300031852 Bacteria 16007
118 Ga0307409_100000097 3300031995 Bacteria 31926
119 Ga0307416_100000139 3300032002 Bacteria 42661
120 Ga0373951_0026164 3300035091 Bacteria 1358
121 Ga0373942_0022124 3300035207 Bacteria 1611
122 Ga0373935_0089726 3300035692 Bacteria 2011
123 Ga0395905_0000026 3300037471 Bacteria 315051
124 Ga0395905_0643796 3300037471 Bacteria 962
125 Ga0436364_0795555 3300037853 Bacteria 5775
126 Ga0436365_1418877 3300039437 Bacteria 1868
127 Ga0451807_0288258 3300041486 Unclassified 1036
128 Ga0451577_0032358 3300042876 Bacteria 4712
129 Ga0451577_0114886 3300042876 Bacteria 2410
130 Ga0451577_0132004 3300042876 Bacteria 2241
131 Ga0451577_0198121 3300042876 Bacteria 1813
132 Ga0451577_0411596 3300042876 Bacteria 1227
133 Ga0453683_0001810 3300044673 Bacteria 17659
134 Ga0466966_0124498 3300044684 Unclassified 1581
135 Ga0466961_0123282 3300044693 Unclassified 1626
136 Ga0466963_0031017 3300044694 Bacteria 3453
137 Ga0453684_0009998 3300044712 Bacteria 16346
138 Ga0453684_0032456 3300044712 Bacteria 7308
139 Ga0453684_0039898 3300044712 Bacteria 6386
140 Ga0453684_0063707 3300044712 Bacteria 4713
141 Ga0453684_0085172 3300044712 Bacteria 3928
142 Ga0453684_0133888 3300044712 Bacteria 2970
143 Ga0453684_0214230 3300044712 Bacteria 2236
144 Ga0451576_0000052 3300045051 Bacteria 310414
145 Ga0451576_0003063 3300045051 Bacteria 23511
146 Ga0451576_0065217 3300045051 Bacteria 3792
147 Ga0451576_0082059 3300045051 Bacteria 3353
148 Ga0451576_0242153 3300045051 Bacteria 1884
149 Ga0451576_0606969 3300045051 Bacteria 1150
150 Ga0466967_0134390 3300045976 Bacteria 2299
151 Ga0501031_0003703 3300049568 Bacteria 9832
152 Ga0501032_0000568 3300049569 Bacteria 29936
153 Ga0501032_0000961 3300049569 Bacteria 23289
154 Ga0501033_0000873 3300049570 Bacteria 27545
155 Ga0501033_0009203 3300049570 Bacteria 7606
156 Ga0501034_0021175 3300049571 Bacteria 6632
157 Ga0501034_0094319 3300049571 Bacteria 2989
158 Ga0501036_0015830 3300049572 Bacteria 6297
159 Ga0501036_0227316 3300049572 Bacteria 1566
160 Ga0501037_0058946 3300049573 Bacteria 2801
161 Ga0501038_0035451 3300049574 Bacteria 4380
162 Ga0501042_0275470 3300049578 Bacteria 1215
163 Ga0501043_0151017 3300049579 Bacteria 1818
164 Ga0501046_0002902 3300049580 Bacteria 15895
165 Ga0501046_0011249 3300049580 Bacteria 7661
166 Ga0501046_0024506 3300049580 Bacteria 4947
167 Ga0501046_0037858 3300049580 Bacteria 3874
168 Ga0501047_0004280 3300049581 Bacteria 13438
169 Ga0501047_0205781 3300049581 Unclassified 1827
170 Ga0501047_0264951 3300049581 Bacteria 1565
171 Ga0501048_0019523 3300049582 Bacteria 4971
172 Ga0501048_0038902 3300049582 Bacteria 3413
173 Ga0501070_0000233 3300049586 Bacteria 52695
174 Ga0501080_0260894 3300049742 Bacteria 1579
175 Ga0501083_0001211 3300049744 Bacteria 17470
176 Ga0501083_0005604 3300049744 Bacteria 8888
177 Ga0501083_0026920 3300049744 Bacteria 3972
178 Ga0501083_0052376 3300049744 Bacteria 2742
179 Ga0501035_0001152 3300049822 Bacteria 27641
180 Ga0501035_0005817 3300049822 Bacteria 11623
181 Ga0501044_0001466 3300049823 Bacteria 27696
182 Ga0501044_0002018 3300049823 Bacteria 23414
183 Ga0501044_0014307 3300049823 Bacteria 8564
184 Ga0501044_0023002 3300049823 Bacteria 6633
185 Ga0501044_0111810 3300049823 Bacteria 2739
186 Ga0500641_0010389 3300053096 Bacteria 3363
187 Ga0500618_008031 3300053125 Bacteria 2972
188 Ga0500568_0027144 3300053139 Bacteria 2396
189 Ga0500616_0058225 3300053153 Bacteria 2011
190 2740031465 2739367866 Bacteria 4215900
191 2788436153 2786546940 Bacteria 6396474
192 2910249722 2910245624 Bacteria 6935613
193 Ga0265337_1000076
194 rootH2_10035167
195 rootH2_10070215
196 rootH2_10101484
197 rootL2_10046851
198 rootL2_10192618
199 rootH1_10011846
200 Ga0070658_10034069
201 Ga0070683_100227342
202 Ga0068869_100020496
203 Ga0068867_100049140
204 Ga0070679_100009933
205 Ga0070679_100334873
206 Ga0068853_100487692
207 Ga0070665_100505679
208 Ga0068856_100019616
209 Ga0068856_100116177
210 Ga0070717_10000030
211 Ga0070717_10157726
212 Ga0097621_100001673
213 Ga0068871_100006057
214 Ga0068865_100010603
215 Ga0105240_10373355
216 Ga0209676_1001401
217 Ga0209050_1027820
218 Ga0207705_10116784
219 Ga0207652_10035893
220 Ga0207704_10071269
221 Ga0207689_10000211
222 Ga0207661_10006575
223 Ga0207677_10177562
224 Ga0207702_10029977
225 Ga0207702_10089726
226 Ga0207648_10063376
227 Ga0207683_10254186
228 Ga0265337_1004160
229 Ga0265319_1000040
230 Ga0265319_1001547
231 Ga0265319_1001742
232 Ga0265319_1003334
233 Ga0265319_1006206
234 Ga0265334_10006629
235 Ga0265334_10051454
236 Ga0265318_10000032
237 Ga0265318_10000844
238 Ga0265318_10001552
239 Ga0265318_10002823
240 Ga0265318_10006306
241 Ga0265318_10035377
242 Ga0265323_10000064
243 Ga0265323_10009440
244 Ga0265323_10014551
245 Ga0265323_10032735
246 Ga0265323_10053557
247 Ga0265322_10000649
248 Ga0265322_10001605
249 Ga0265322_10020132
250 Ga0265336_10012247
251 Ga0265336_10012833
252 Ga0307515_10000250
253 Ga0307515_10070157
254 Ga0307515_10079835
255 Ga0265338_10000098
256 Ga0265338_10000505
257 Ga0265338_10007420
258 Ga0265338_10047016
259 Ga0265324_10000039
260 Ga0265330_10042528
261 Ga0265328_10041907
262 Ga0265320_10000071
263 Ga0265320_10000900
264 Ga0265320_10008628
265 Ga0265320_10013955
266 Ga0265320_10016653
267 Ga0265320_10017376
268 Ga0265320_10019574
269 Ga0265320_10058503
270 Ga0265325_10018010
271 Ga0265325_10023878
272 Ga0265340_10021818
273 Ga0265331_10001795
274 Ga0265327_10000061
275 Ga0265327_10000066
276 Ga0265327_10001302
277 Ga0265327_10001524
278 Ga0265327_10005708
279 Ga0265316_10001079
280 Ga0265316_10027295
281 Ga0265316_10031244
282 Ga0265316_10032454
283 Ga0265316_10033304
284 Ga0265316_10147735
285 Ga0307513_10429385
286 Ga0307408_100000093
287 Ga0265313_10000350
288 Ga0265313_10001657
289 Ga0265313_10006250
290 Ga0265313_10006647
291 Ga0265313_10010981
292 Ga0265313_10016439
293 Ga0265313_10024656
294 Ga0307508_10000084
295 Ga0265314_10000072
296 Ga0265314_10001488
297 Ga0265314_10003079
298 Ga0265314_10009942
299 Ga0265314_10029950
300 Ga0265314_10118419
301 Ga0265314_10185841
302 Ga0265342_10010317
303 Ga0265342_10017365
304 Ga0265342_10017833
305 Ga0265342_10035264
306 Ga0265342_10036945
307 Ga0265342_10052731
308 Ga0265342_10154485
309 Ga0307410_10000495
310 Ga0307409_100000097
311 Ga0307416_100000139
312 Ga0373951_0026164
313 Ga0373942_0022124
314 Ga0373935_0089726
315 Ga0395905_0000026
316 Ga0395905_0643796
317 Ga0436364_0795555
318 Ga0436365_1418877
319 Ga0451807_0288258
320 Ga0451577_0032358
321 Ga0451577_0114886
322 Ga0451577_0132004
323 Ga0451577_0198121
324 Ga0451577_0411596
325 Ga0453683_0001810
326 Ga0466966_0124498
327 Ga0466961_0123282
328 Ga0466963_0031017
329 Ga0453684_0009998
330 Ga0453684_0032456
331 Ga0453684_0039898
332 Ga0453684_0063707
333 Ga0453684_0085172
334 Ga0453684_0133888
335 Ga0453684_0214230
336 Ga0451576_0000052
337 Ga0451576_0003063
338 Ga0451576_0065217
339 Ga0451576_0082059
340 Ga0451576_0242153
341 Ga0451576_0606969
342 Ga0466967_0134390
343 Ga0501031_0003703
344 Ga0501032_0000568
345 Ga0501032_0000961
346 Ga0501033_0000873
347 Ga0501033_0009203
348 Ga0501034_0021175
349 Ga0501034_0094319
350 Ga0501036_0015830
351 Ga0501036_0227316
352 Ga0501037_0058946
353 Ga0501038_0035451
354 Ga0501042_0275470
355 Ga0501043_0151017
356 Ga0501046_0002902
357 Ga0501046_0011249
358 Ga0501046_0024506
359 Ga0501046_0037858
360 Ga0501047_0004280
361 Ga0501047_0205781
362 Ga0501047_0264951
363 Ga0501048_0019523
364 Ga0501048_0038902
365 Ga0501070_0000233
366 Ga0501080_0260894
367 Ga0501083_0001211
368 Ga0501083_0005604
369 Ga0501083_0026920
370 Ga0501083_0052376
371 Ga0501035_0001152
372 Ga0501035_0005817
373 Ga0501044_0001466
374 Ga0501044_0002018
375 Ga0501044_0014307
376 Ga0501044_0023002
377 Ga0501044_0111810
378 Ga0500641_0010389
379 Ga0500618_008031
380 Ga0500568_0027144
381 Ga0500616_0058225
382 2740031465
383 2788436153
384 2910249722

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10672

Methyltrans_SAM

S-adenosylmethionine-dependent methyltransferase

100

270

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2igt-assembly1.cif.gz_C crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens 0.9422 6 296
2igt-assembly1.cif.gz_A crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens 0.9395 6 296
2igt-assembly1.cif.gz_C crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens 0.9237 6 296
2igt-assembly1.cif.gz_A crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens 0.9211 6 296
2igt-assembly1.cif.gz_B crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens 0.9085 1 296
ID Description Score Start End Superfamily
2igtC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9173 75 296 3.40.50.150
af_Q557I0_186_398_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8638 80 258 3.40.50.150
2igtC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8293 75 296 3.40.50.150
2igtB02 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8161 15 77 2.60.40.1180
1ws6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.813 104 251 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3D0EBL7-F1-model_v4 deleted 0.9798 124 295
AF-A0A354TXF4-F1-model_v4 deleted 0.9794 175 295
AF-A0A7U9RVI4-F1-model_v4 Ribosomal RNA large subunit methyltransferase K/L (EC 2.1.1.264) 0.9776 142 296 GO:0008168
GO:0032259
AF-A0A3D4JEI0-F1-model_v4 SAM-dependent methyltransferase 0.9772 97 296 GO:0008168
GO:0032259
AF-A0A356W6V2-F1-model_v4 SAM-dependent methyltransferase 0.9763 197 295 GO:0008168
GO:0032259

Map