F295528

General Info

Members Datasets Scaffolds Average Seq Length
192 118 384 288

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100111984|Ga0075435_1001119842
Length 331
Sequence MHVFARVPKAAAPLKVPIGVCVLDDEWLGPDHRTGHPSVAIALDCCAVNDKQILITGATNGIGLAAAEALAALGANLAIVGRNKTRTRIASARIRAAVGRGATVATFIADLSSQASVRRLAAEVLARYPKLDVLVNNAGAMYGTRQLTKDGIELTWAVNHLAPFLLSKLLLHRLKESAPARIITTASQAHQGAHIPFDDLNAERSYRGFGRYCETKLANILFTIELARRLDGTGVTANCFHPGLVATGFNRNNGLLMDLGMTILRPASRSPQKGAETLVWLATSPDVANVSGVYFFDQEQRPPSPAAQDTETAGRLWEISERQCAASRRPL

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
15 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
35 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
46 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
47 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
48 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
49 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
50 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
51 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
52 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
53 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
54 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
62 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
63 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
67 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
68 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
69 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
70 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
71 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
72 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
73 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
74 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
75 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
76 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
77 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
78 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
79 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
80 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
81 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
82 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
83 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
87 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
91 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
92 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
93 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
94 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
95 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
96 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
97 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
98 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
99 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
100 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
101 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
102 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
103 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
104 2738541295 Bacillus sp. OK085 Isolate Unclassified
105 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
106 2738541358 Bacillus sp. OV752 Isolate Unclassified
107 2738543006 Bacillus sp. OK077 Isolate Unclassified
108 2818991459 Paenibacillus sp. 597 Isolate Unclassified
109 2857472729 Cohnella sp. R-74144 Isolate Unclassified
110 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
111 2965761152 Bacillus sp. COPE52 Isolate Unclassified
112 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
113 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
114 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
115 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
116 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
117 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
118 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.58
Metatranscriptomes 0
Isolates 10.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0
Rhizoplane 14.06
Rhizosphere 71.88
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100111984 3300007076 Bacteria 2270
2 JGI25151J46595_10012678 3300003187 Bacteria 3826
3 JGI25151J46595_10014561 3300003187 Bacteria 3499
4 JGI25151J46595_10042611 3300003187 Bacteria 1633
5 rootL2_10086759 3300003322 Bacteria 5520
6 Ga0070713_100168535 3300005436 Bacteria 1960
7 Ga0070713_100207024 3300005436 Bacteria 1774
8 Ga0070710_10046245 3300005437 Bacteria 2422
9 Ga0070708_100059384 3300005445 Bacteria 3409
10 Ga0070706_100000549 3300005467 Bacteria 43586
11 Ga0070706_100045928 3300005467 Bacteria 4032
12 Ga0070706_100216675 3300005467 Bacteria 1787
13 Ga0070706_100311484 3300005467 Bacteria 1468
14 Ga0070707_100003685 3300005468 Bacteria 14453
15 Ga0070707_100014300 3300005468 Bacteria 7441
16 Ga0070707_100068909 3300005468 Bacteria 3405
17 Ga0070707_100233152 3300005468 Bacteria 1791
18 Ga0070707_100396163 3300005468 Bacteria 1341
19 Ga0070698_100000624 3300005471 Bacteria 38135
20 Ga0070698_100171101 3300005471 Bacteria 2113
21 Ga0070698_100187623 3300005471 Bacteria 2005
22 Ga0070699_100139022 3300005518 Bacteria 2143
23 Ga0070699_100301337 3300005518 Bacteria 1438
24 Ga0070697_100221214 3300005536 Bacteria 1613
25 Ga0070697_100357406 3300005536 Bacteria 1262
26 Ga0081455_10044345 3300005937 Bacteria 3881
27 Ga0081455_10082820 3300005937 Bacteria 2623
28 Ga0070717_10006417 3300006028 Bacteria 8650
29 Ga0070715_10062979 3300006163 Bacteria 1634
30 Ga0070716_100146172 3300006173 Bacteria 1515
31 Ga0070712_100316731 3300006175 Bacteria 1267
32 Ga0075428_100064578 3300006844 Bacteria 4009
33 Ga0075428_100093999 3300006844 Bacteria 3269
34 Ga0075428_100291448 3300006844 Bacteria 1755
35 Ga0075428_100388809 3300006844 Bacteria 1495
36 Ga0075430_100080602 3300006846 Bacteria 2727
37 Ga0075430_100228683 3300006846 Bacteria 1542
38 Ga0075431_100001303 3300006847 Bacteria 22800
39 Ga0075431_100005911 3300006847 Bacteria 12104
40 Ga0075431_100036383 3300006847 Bacteria 5070
41 Ga0075431_100294911 3300006847 Bacteria 1639
42 Ga0075431_100322538 3300006847 Bacteria 1557
43 Ga0075433_10002927 3300006852 Bacteria 13103
44 Ga0075434_100003125 3300006871 Bacteria 14754
45 Ga0075434_100252014 3300006871 Bacteria 1784
46 Ga0075429_100166315 3300006880 Unclassified 1932
47 Ga0075429_100172882 3300006880 Bacteria 1892
48 Ga0075435_100011310 3300007076 Bacteria 6559
49 Ga0075435_100014066 3300007076 Bacteria 5969
50 Ga0105251_10024455 3300009011 Bacteria 3102
51 Ga0105244_10008618 3300009036 Bacteria 6350
52 Ga0105250_10011503 3300009092 Bacteria 3669
53 Ga0105250_10039442 3300009092 Bacteria 1894
54 Ga0111539_10012080 3300009094 Bacteria 10831
55 Ga0111539_10017813 3300009094 Bacteria 8795
56 Ga0105247_10223740 3300009101 Unclassified 1275
57 Ga0114129_10005110 3300009147 Bacteria 18465
58 Ga0105243_10648832 3300009148 Bacteria 1023
59 Ga0105248_10478189 3300009177 Unclassified 1404
60 Ga0157375_10116522 3300013308 Bacteria 2776
61 Ga0157375_10270609 3300013308 Bacteria 1861
62 Ga0163163_10156540 3300014325 Bacteria 2323
63 Ga0163163_10283639 3300014325 Bacteria 1708
64 Ga0213876_10094288 3300021384 Bacteria 1585
65 Ga0209025_1003881 3300025294 Bacteria 13523
66 Ga0209025_1023249 3300025294 Bacteria 3247
67 Ga0209025_1024362 3300025294 Bacteria 3126
68 Ga0209025_1051569 3300025294 Bacteria 1633
69 Ga0207696_1006844 3300025711 Bacteria 4537
70 Ga0207655_1007099 3300025728 Bacteria 7318
71 Ga0207713_1027178 3300025735 Bacteria 2604
72 Ga0207684_10000008 3300025910 Bacteria 601602
73 Ga0207684_10024756 3300025910 Bacteria 5117
74 Ga0207684_10162954 3300025910 Bacteria 1920
75 Ga0207684_10257560 3300025910 Bacteria 1505
76 Ga0207693_10276770 3300025915 Bacteria 1315
77 Ga0207646_10030253 3300025922 Bacteria 4911
78 Ga0207646_10087340 3300025922 Bacteria 2790
79 Ga0207646_10130197 3300025922 Bacteria 2264
80 Ga0207646_10262596 3300025922 Bacteria 1560
81 Ga0207659_10336195 3300025926 Bacteria 1250
82 Ga0207700_10095901 3300025928 Bacteria 2353
83 Ga0207700_10175502 3300025928 Bacteria 1791
84 Ga0207665_10066205 3300025939 Bacteria 2458
85 Ga0207675_100105050 3300026118 Bacteria 2662
86 Ga0207428_10082094 3300027907 Bacteria 2516
87 Ga0373940_0039272 3300035088 Bacteria 1295
88 Ga0373960_0002883 3300035121 Bacteria 3891
89 Ga0373961_0020867 3300035241 Bacteria 1737
90 Ga0373962_0056681 3300035242 Bacteria 1141
91 Ga0373931_0001072 3300035691 Bacteria 11570
92 Ga0373935_0359132 3300035692 Bacteria 1040
93 Ga0373927_0053861 3300035695 Bacteria 2603
94 Ga0373947_0242636 3300035725 Bacteria 1189
95 Ga0395899_0042068 3300037312 Bacteria 3412
96 Ga0395900_0044592 3300037418 Bacteria 4568
97 Ga0395898_0015691 3300037466 Bacteria 7762
98 Ga0395905_0109528 3300037471 Bacteria 2593
99 Ga0436364_1413680 3300037853 Bacteria 13789
100 Ga0395901_0124204 3300038443 Bacteria 2712
101 Ga0436365_0298726 3300039437 Bacteria 23715
102 Ga0436365_0624968 3300039437 Bacteria 39516
103 Ga0436365_1451863 3300039437 Bacteria 1335
104 Ga0436360_0909025 3300039438 Bacteria 3263
105 Ga0436361_0068980 3300039447 Bacteria 2992
106 Ga0436361_0512148 3300039447 Bacteria 1502
107 Ga0436361_0609195 3300039447 Bacteria 1636
108 Ga0436361_1164525 3300039447 Bacteria 1637
109 Ga0436363_1687829 3300039450 Bacteria 3265
110 Ga0466966_0026409 3300044684 Bacteria 3790
111 Ga0466967_0010931 3300045976 Bacteria 6842
112 Ga0495603_0117614 3300046455 Unclassified 1549
113 Ga0495584_0136011 3300046491 Bacteria 1248
114 Ga0495585_0048364 3300046492 Bacteria 2365
115 Ga0495647_0136243 3300046681 Bacteria 1044
116 Ga0495613_0003908 3300046689 Bacteria 11153
117 Ga0495676_0080571 3300047321 Bacteria 2472
118 Ga0496101_0041184 3300048904 Bacteria 3293
119 Ga0496102_0053444 3300048905 Bacteria 3682
120 Ga0496104_0000929 3300048907 Bacteria 25139
121 Ga0496104_0016720 3300048907 Bacteria 6668
122 Ga0496104_0131476 3300048907 Bacteria 2404
123 Ga0496104_0270733 3300048907 Bacteria 1611
124 Ga0496105_0077036 3300048908 Bacteria 2754
125 Ga0496105_0240279 3300048908 Bacteria 1470
126 Ga0496106_0011530 3300048909 Bacteria 6535
127 Ga0496108_0004859 3300048911 Bacteria 10851
128 Ga0496108_0029415 3300048911 Bacteria 4549
129 Ga0496109_0077445 3300048912 Bacteria 3060
130 Ga0496109_0108333 3300048912 Bacteria 2582
131 Ga0496109_0258616 3300048912 Bacteria 1640
132 Ga0496109_0367944 3300048912 Bacteria 1358
133 Ga0496109_0389145 3300048912 Bacteria 1317
134 Ga0496110_0000343 3300048913 Bacteria 31059
135 Ga0496110_0001853 3300048913 Bacteria 15605
136 Ga0496110_0043299 3300048913 Bacteria 3931
137 Ga0496110_0069577 3300048913 Bacteria 3117
138 Ga0496111_0005955 3300048914 Bacteria 7867
139 Ga0496111_0069322 3300048914 Bacteria 2564
140 Ga0496111_0109008 3300048914 Bacteria 2039
141 Ga0496111_0153881 3300048914 Bacteria 1706
142 Ga0496112_0112296 3300048915 Bacteria 2695
143 Ga0496112_0360032 3300048915 Bacteria 1397
144 Ga0496113_0014132 3300048916 Bacteria 5436
145 Ga0501037_0333858 3300049573 Bacteria 1048
146 Ga0501040_0341275 3300049576 Bacteria 1072
147 Ga0501046_0019389 3300049580 Bacteria 5643
148 Ga0501068_0045269 3300049584 Bacteria 2651
149 Ga0501077_0296907 3300049593 Unclassified 1029
150 Ga0501044_0604384 3300049823 Bacteria 990
151 nmdc:mga05p37_110992_c1 3300050507 Bacteria 3373
152 nmdc:mga05p37_22107_c1 3300050507 Bacteria 7710
153 nmdc:mga09592_16810_c1 3300050508 Bacteria 5988
154 nmdc:mga09592_3202_c1 3300050508 Bacteria 13264
155 nmdc:mga09592_41127_c1 3300050508 Bacteria 3886
156 nmdc:mga0qj67_44685_c1 3300050509 Bacteria 3493
157 nmdc:mga06r32_150383_c1 3300050510 Bacteria 2306
158 nmdc:mga06r32_150584_c1 3300050510 Bacteria 2305
159 nmdc:mga06r32_4390_c1 3300050510 Bacteria 12611
160 nmdc:mga06r32_50007_c1 3300050510 Bacteria 3999
161 nmdc:mga06r32_8023_c1 3300050510 Bacteria 9495
162 nmdc:mga08y16_12274_c1 3300050511 Bacteria 9005
163 nmdc:mga08y16_367597_c1 3300050511 Bacteria 1476
164 nmdc:mga0n895_207927_c1 3300050512 Bacteria 1988
165 nmdc:mga0n895_261969_c1 3300050512 Bacteria 1754
166 nmdc:mga0rr50_11052_c1 3300050513 Bacteria 5757
167 nmdc:mga0rr50_21963_c1 3300050513 Bacteria 4369
168 nmdc:mga0a205_109501_c1 3300050515 Bacteria 2660
169 nmdc:mga0a205_96290_c1 3300050515 Unclassified 2858
170 Ga0500654_057482 3300053099 Bacteria 2026
171 Ga0501084_0099316 3300054114 Bacteria 2444
172 Ga0501084_0308032 3300054114 Bacteria 1338
173 2573040056 2571042588 Bacteria 5045676
174 2580931712 2579778775 Bacteria 5360914
175 2621274483 2619619294 Bacteria 5575484
176 2644422148 2643221676 Bacteria 8119172
177 2705996450 2703719227 Bacteria 5631989
178 2738815762 2738541295 Bacteria 5730091
179 2738840183 2738541299 Bacteria 4020721
180 2739157686 2738541358 Bacteria 5932299
181 2739209778 2738543006 Bacteria 5904091
182 2819669867 2818991459 Bacteria 8736032
183 2857478841 2857472729 Bacteria 6568124
184 2919431227 2919425241 Bacteria 8055701
185 2965765942 2965761152 Bacteria 5806513
186 2971515369 2971511577 Bacteria 5404012
187 2979088214 2979083700 Bacteria 5894929
188 2980181463 2980176882 Bacteria 5397533
189 3001270052 3001267043 Bacteria 4823521
190 3001275391 3001272096 Bacteria 4729684
191 3006985316 3006984091 Bacteria 4207523
192 8057586974 8057582654 Bacteria 5218944
193 Ga0075435_100111984
194 JGI25151J46595_10012678
195 JGI25151J46595_10014561
196 JGI25151J46595_10042611
197 rootL2_10086759
198 Ga0070713_100168535
199 Ga0070713_100207024
200 Ga0070710_10046245
201 Ga0070708_100059384
202 Ga0070706_100000549
203 Ga0070706_100045928
204 Ga0070706_100216675
205 Ga0070706_100311484
206 Ga0070707_100003685
207 Ga0070707_100014300
208 Ga0070707_100068909
209 Ga0070707_100233152
210 Ga0070707_100396163
211 Ga0070698_100000624
212 Ga0070698_100171101
213 Ga0070698_100187623
214 Ga0070699_100139022
215 Ga0070699_100301337
216 Ga0070697_100221214
217 Ga0070697_100357406
218 Ga0081455_10044345
219 Ga0081455_10082820
220 Ga0070717_10006417
221 Ga0070715_10062979
222 Ga0070716_100146172
223 Ga0070712_100316731
224 Ga0075428_100064578
225 Ga0075428_100093999
226 Ga0075428_100291448
227 Ga0075428_100388809
228 Ga0075430_100080602
229 Ga0075430_100228683
230 Ga0075431_100001303
231 Ga0075431_100005911
232 Ga0075431_100036383
233 Ga0075431_100294911
234 Ga0075431_100322538
235 Ga0075433_10002927
236 Ga0075434_100003125
237 Ga0075434_100252014
238 Ga0075429_100166315
239 Ga0075429_100172882
240 Ga0075435_100011310
241 Ga0075435_100014066
242 Ga0105251_10024455
243 Ga0105244_10008618
244 Ga0105250_10011503
245 Ga0105250_10039442
246 Ga0111539_10012080
247 Ga0111539_10017813
248 Ga0105247_10223740
249 Ga0114129_10005110
250 Ga0105243_10648832
251 Ga0105248_10478189
252 Ga0157375_10116522
253 Ga0157375_10270609
254 Ga0163163_10156540
255 Ga0163163_10283639
256 Ga0213876_10094288
257 Ga0209025_1003881
258 Ga0209025_1023249
259 Ga0209025_1024362
260 Ga0209025_1051569
261 Ga0207696_1006844
262 Ga0207655_1007099
263 Ga0207713_1027178
264 Ga0207684_10000008
265 Ga0207684_10024756
266 Ga0207684_10162954
267 Ga0207684_10257560
268 Ga0207693_10276770
269 Ga0207646_10030253
270 Ga0207646_10087340
271 Ga0207646_10130197
272 Ga0207646_10262596
273 Ga0207659_10336195
274 Ga0207700_10095901
275 Ga0207700_10175502
276 Ga0207665_10066205
277 Ga0207675_100105050
278 Ga0207428_10082094
279 Ga0373940_0039272
280 Ga0373960_0002883
281 Ga0373961_0020867
282 Ga0373962_0056681
283 Ga0373931_0001072
284 Ga0373935_0359132
285 Ga0373927_0053861
286 Ga0373947_0242636
287 Ga0395899_0042068
288 Ga0395900_0044592
289 Ga0395898_0015691
290 Ga0395905_0109528
291 Ga0436364_1413680
292 Ga0395901_0124204
293 Ga0436365_0298726
294 Ga0436365_0624968
295 Ga0436365_1451863
296 Ga0436360_0909025
297 Ga0436361_0068980
298 Ga0436361_0512148
299 Ga0436361_0609195
300 Ga0436361_1164525
301 Ga0436363_1687829
302 Ga0466966_0026409
303 Ga0466967_0010931
304 Ga0495603_0117614
305 Ga0495584_0136011
306 Ga0495585_0048364
307 Ga0495647_0136243
308 Ga0495613_0003908
309 Ga0495676_0080571
310 Ga0496101_0041184
311 Ga0496102_0053444
312 Ga0496104_0000929
313 Ga0496104_0016720
314 Ga0496104_0131476
315 Ga0496104_0270733
316 Ga0496105_0077036
317 Ga0496105_0240279
318 Ga0496106_0011530
319 Ga0496108_0004859
320 Ga0496108_0029415
321 Ga0496109_0077445
322 Ga0496109_0108333
323 Ga0496109_0258616
324 Ga0496109_0367944
325 Ga0496109_0389145
326 Ga0496110_0000343
327 Ga0496110_0001853
328 Ga0496110_0043299
329 Ga0496110_0069577
330 Ga0496111_0005955
331 Ga0496111_0069322
332 Ga0496111_0109008
333 Ga0496111_0153881
334 Ga0496112_0112296
335 Ga0496112_0360032
336 Ga0496113_0014132
337 Ga0501037_0333858
338 Ga0501040_0341275
339 Ga0501046_0019389
340 Ga0501068_0045269
341 Ga0501077_0296907
342 Ga0501044_0604384
343 nmdc:mga05p37_110992_c1
344 nmdc:mga05p37_22107_c1
345 nmdc:mga09592_16810_c1
346 nmdc:mga09592_3202_c1
347 nmdc:mga09592_41127_c1
348 nmdc:mga0qj67_44685_c1
349 nmdc:mga06r32_150383_c1
350 nmdc:mga06r32_150584_c1
351 nmdc:mga06r32_4390_c1
352 nmdc:mga06r32_50007_c1
353 nmdc:mga06r32_8023_c1
354 nmdc:mga08y16_12274_c1
355 nmdc:mga08y16_367597_c1
356 nmdc:mga0n895_207927_c1
357 nmdc:mga0n895_261969_c1
358 nmdc:mga0rr50_11052_c1
359 nmdc:mga0rr50_21963_c1
360 nmdc:mga0a205_109501_c1
361 nmdc:mga0a205_96290_c1
362 Ga0500654_057482
363 Ga0501084_0099316
364 Ga0501084_0308032
365 2573040056
366 2580931712
367 2621274483
368 2644422148
369 2705996450
370 2738815762
371 2738840183
372 2739157686
373 2739209778
374 2819669867
375 2857478841
376 2919431227
377 2965765942
378 2971515369
379 2979088214
380 2980181463
381 3001270052
382 3001275391
383 3006985316
384 8057586974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

51

255

0.92

PF08659

KR

KR domain

52

190

0.88

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

57

296

0.8

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

53

252

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xg5-assembly2.cif.gz_A structure of human putative dehydrogenase mgc4172 in complex with nadp 0.8638 12 258
8g9m-assembly1.cif.gz_A acinetobacter_baumannii short-chain dehydrogenase 0.8614 12 268
1xg5-assembly1.cif.gz_C structure of human putative dehydrogenase mgc4172 in complex with nadp 0.8538 12 258
7e28-assembly1.cif.gz_B crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.8503 15 259
2jap-assembly1.cif.gz_C clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta-lactamase inhibitor clavulanic acid 0.8446 12 269
ID Description Score Start End Superfamily
af_A0A368UI72_22_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9801 15 88 3.40.50.720
af_A8WG01_1_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9594 44 299 3.40.50.720
af_Q9VE80_46_330_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9494 9 300 3.40.50.720
af_A2BGW2_5_289_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9449 11 300 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9401 15 63 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A327HBV8-F1-model_v4 Short-chain dehydrogenase 0.963 14 299 GO:0016491
AF-A0A6L5F597-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9616 12 300 GO:0016491
AF-A0A0L8FI67-F1-model_v4 Retinol dehydrogenase 12 0.9613 14 298 GO:0016491
AF-A0A4R6FWE7-F1-model_v4 deleted 0.9575 15 298
AF-A0A7T9FVD7-F1-model_v4 deleted 0.9553 13 299

Map