F295337

General Info

Members Datasets Scaffolds Average Seq Length
192 142 384 188

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100171300|Ga0070665_1001713002
Length 186
Sequence MSGELKGHKIAILATDGCEQVELTDPKKNVEAAGASTEVLSVKDGSIKGWKFTDWGDSVRVDKQVAKAKVDDYDALILPGGQINPDKLRMEKAAVDFVRNFVASGKPVAAICHGPWMLIEAGVVKGKTVTSWPSVRTDLVNAGAKWVDREVAEDGNIITSRNPDDIPAFSKKLTEVVAKSPQHAHA

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
101 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
129 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
137 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
142 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 2.6
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.31
Nodule 0
Rhizoplane 8.33
Rhizosphere 61.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100171300 3300005548 Bacteria 2172
2 JGI25153J46596_10003325 3300003215 Bacteria 9039
3 Ga0055526_1038435 3300003771 Bacteria 1234
4 Ga0055536_1000651 3300003781 Bacteria 23502
5 Ga0055536_1010149 3300003781 Bacteria 3779
6 Ga0055534_1003312 3300003784 Bacteria 5105
7 Ga0055534_1004579 3300003784 Bacteria 3952
8 Ga0055530_10000149 3300003791 Bacteria 63152
9 Ga0055530_10002044 3300003791 Bacteria 13592
10 Ga0055531_10018894 3300003794 Bacteria 2820
11 Ga0065165_1008317 3300005262 Bacteria 4883
12 Ga0065715_10105059 3300005293 Bacteria 2917
13 Ga0070670_100272808 3300005331 Bacteria 1476
14 Ga0068869_100228006 3300005334 Bacteria 1479
15 Ga0070661_100016061 3300005344 Bacteria 5284
16 Ga0070661_100697546 3300005344 Bacteria 827
17 Ga0070713_100231234 3300005436 Bacteria 1681
18 Ga0070694_100390391 3300005444 Bacteria 1087
19 Ga0070678_100247562 3300005456 Bacteria 1493
20 Ga0070679_100262113 3300005530 Bacteria 1683
21 Ga0070684_100054998 3300005535 Bacteria 3468
22 Ga0070665_100115730 3300005548 Bacteria 2684
23 Ga0068855_100085117 3300005563 Bacteria 3659
24 Ga0068855_100273197 3300005563 Bacteria 1879
25 Ga0070664_100080406 3300005564 Bacteria 2807
26 Ga0070664_100687874 3300005564 Bacteria 952
27 Ga0068856_100017121 3300005614 Bacteria 7025
28 Ga0068852_100007211 3300005616 Bacteria 8106
29 Ga0068862_100348343 3300005844 Bacteria 1374
30 Ga0075365_10308395 3300006038 Bacteria 1114
31 Ga0075365_10361475 3300006038 Bacteria 1023
32 Ga0075364_10165138 3300006051 Bacteria 1495
33 Ga0070716_100665181 3300006173 Bacteria 791
34 Ga0075362_10144470 3300006177 Bacteria 1138
35 Ga0075366_10266293 3300006195 Bacteria 1046
36 Ga0075370_10383493 3300006353 Bacteria 842
37 Ga0075431_100651420 3300006847 Bacteria 1034
38 Ga0075434_100518678 3300006871 Bacteria 1212
39 Ga0105238_10095391 3300009551 Bacteria 2962
40 Ga0105239_10075330 3300010375 Bacteria 3710
41 Ga0105239_10536953 3300010375 Bacteria 1331
42 Ga0157371_10476669 3300013102 Bacteria 919
43 Ga0157369_10195057 3300013105 Bacteria 2127
44 Ga0157369_10222704 3300013105 Bacteria 1974
45 Ga0157374_10208109 3300013296 Bacteria 1917
46 Ga0157372_10148258 3300013307 Bacteria 2706
47 Ga0157372_10544331 3300013307 Bacteria 1353
48 Ga0163163_10011142 3300014325 Bacteria 8140
49 Ga0163163_11362648 3300014325 Bacteria 771
50 Ga0157379_10074696 3300014968 Bacteria 3035
51 Ga0157376_10045938 3300014969 Bacteria 3598
52 Ga0197907_10382908 3300020069 Bacteria 703
53 Ga0206353_10198323 3300020082 Bacteria 1574
54 Ga0206353_10758357 3300020082 Bacteria 1366
55 Ga0213875_10008507 3300021388 Bacteria 5251
56 Ga0224712_10019250 3300022467 Bacteria 2298
57 Ga0209675_1000037 3300025291 Bacteria 250958
58 Ga0209675_1000135 3300025291 Bacteria 100154
59 Ga0209676_1000019 3300025292 Bacteria 620012
60 Ga0209676_1000227 3300025292 Bacteria 123708
61 Ga0209676_1001265 3300025292 Bacteria 26276
62 Ga0209676_1002780 3300025292 Bacteria 11648
63 Ga0209676_1003054 3300025292 Bacteria 10805
64 Ga0209564_1012275 3300025295 Bacteria 3749
65 Ga0209758_1000021 3300025297 Bacteria 697691
66 Ga0209050_1000068 3300025298 Bacteria 298849
67 Ga0209050_1000798 3300025298 Bacteria 44543
68 Ga0209050_1010069 3300025298 Bacteria 4719
69 Ga0209050_1013690 3300025298 Bacteria 3575
70 Ga0209257_1000768 3300025304 Bacteria 47870
71 Ga0209257_1001030 3300025304 Bacteria 37390
72 Ga0209257_1005174 3300025304 Bacteria 9399
73 Ga0209257_1008988 3300025304 Bacteria 5486
74 Ga0207692_10150311 3300025898 Bacteria 1333
75 Ga0207647_10006148 3300025904 Bacteria 8742
76 Ga0207647_10121404 3300025904 Bacteria 1541
77 Ga0207705_10293859 3300025909 Bacteria 1245
78 Ga0207654_10440332 3300025911 Bacteria 912
79 Ga0207693_10163388 3300025915 Bacteria 1752
80 Ga0207660_10508317 3300025917 Bacteria 978
81 Ga0207657_10430221 3300025919 Bacteria 1037
82 Ga0207649_10050381 3300025920 Bacteria 2575
83 Ga0207649_10791651 3300025920 Bacteria 740
84 Ga0207652_11270827 3300025921 Bacteria 638
85 Ga0207690_10162363 3300025932 Bacteria 1667
86 Ga0207706_10306569 3300025933 Bacteria 1383
87 Ga0207679_10121438 3300025945 Bacteria 2081
88 Ga0207667_10133970 3300025949 Bacteria 2552
89 Ga0207640_10023179 3300025981 Bacteria 3728
90 Ga0207703_10370885 3300026035 Bacteria 1322
91 Ga0207639_10274372 3300026041 Bacteria 1480
92 Ga0207702_10014361 3300026078 Bacteria 6576
93 Ga0207698_10108265 3300026142 Bacteria 2322
94 Ga0207698_11660048 3300026142 Bacteria 654
95 Ga0209371_1000449 3300027312 Bacteria 41139
96 Ga0268266_10119251 3300028379 Bacteria 2346
97 Ga0268265_10777802 3300028380 Bacteria 931
98 Ga0268256_1003131 3300030500 Bacteria 7708
99 Ga0316576_10085066 3300031727 Bacteria 2351
100 Ga0307413_10059836 3300031824 Bacteria 2342
101 Ga0307409_100921638 3300031995 Bacteria 888
102 Ga0307414_10090900 3300032004 Bacteria 2267
103 Ga0307411_10048291 3300032005 Bacteria 2758
104 Ga0307415_101336286 3300032126 Bacteria 680
105 Ga0316584_0246280 3300036712 Bacteria 1307
106 Ga0395899_0011215 3300037312 Bacteria 6867
107 Ga0395899_0014303 3300037312 Bacteria 6057
108 Ga0395900_0018165 3300037418 Bacteria 7174
109 Ga0395900_0033116 3300037418 Bacteria 5318
110 Ga0395898_0002450 3300037466 Bacteria 21926
111 Ga0395898_0115699 3300037466 Bacteria 2569
112 Ga0395901_0016298 3300038443 Bacteria 7569
113 Ga0395901_0214865 3300038443 Bacteria 2011
114 Ga0451576_0199380 3300045051 Bacteria 2090
115 Ga0495645_0194885 3300046543 Bacteria 1378
116 Ga0495625_0493657 3300046660 Bacteria 749
117 Ga0496100_0145271 3300048903 Bacteria 1686
118 Ga0496101_0204210 3300048904 Bacteria 1529
119 Ga0496102_0093860 3300048905 Bacteria 2780
120 Ga0496102_0375589 3300048905 Bacteria 1338
121 Ga0496103_0551025 3300048906 Bacteria 736
122 Ga0496104_0004739 3300048907 Bacteria 11840
123 Ga0496104_0006343 3300048907 Bacteria 10402
124 Ga0496105_0277777 3300048908 Bacteria 1351
125 Ga0496106_0070150 3300048909 Bacteria 2676
126 Ga0496108_0030183 3300048911 Bacteria 4493
127 Ga0496109_0038184 3300048912 Bacteria 4341
128 Ga0496112_0812283 3300048915 Bacteria 859
129 Ga0496113_0036327 3300048916 Bacteria 3609
130 Ga0496114_0399178 3300048917 Bacteria 1218
131 Ga0496115_0102001 3300048918 Bacteria 2353
132 Ga0496115_0539559 3300048918 Bacteria 933
133 Ga0496116_0242936 3300048919 Bacteria 903
134 Ga0496118_0405737 3300048921 Bacteria 706
135 Ga0496120_0169833 3300048923 Bacteria 1080
136 Ga0496121_0000612 3300048924 Bacteria 66397
137 Ga0496121_0037385 3300048924 Bacteria 4313
138 Ga0496121_0207452 3300048924 Bacteria 1391
139 Ga0496122_0009453 3300048925 Bacteria 10272
140 Ga0496122_0012015 3300048925 Bacteria 8681
141 Ga0496122_0211912 3300048925 Bacteria 1121
142 Ga0496123_0181880 3300048926 Bacteria 1097
143 Ga0496123_0244768 3300048926 Bacteria 888
144 Ga0496126_0020616 3300048929 Bacteria 6457
145 Ga0496126_0121756 3300048929 Bacteria 2262
146 Ga0496126_0124782 3300048929 Bacteria 2230
147 Ga0496126_0152755 3300048929 Bacteria 1978
148 Ga0496126_0184006 3300048929 Bacteria 1773
149 Ga0496126_0406486 3300048929 Bacteria 1103
150 Ga0501031_0263029 3300049568 Bacteria 1121
151 Ga0501034_0126455 3300049571 Bacteria 2541
152 Ga0501036_0018531 3300049572 Bacteria 5834
153 Ga0501036_0245528 3300049572 Bacteria 1501
154 Ga0501037_0364535 3300049573 Bacteria 995
155 Ga0501040_0221095 3300049576 Bacteria 1347
156 Ga0501042_0048741 3300049578 Bacteria 3020
157 Ga0501043_0077090 3300049579 Bacteria 2619
158 Ga0501046_0069425 3300049580 Bacteria 2741
159 Ga0501069_0040552 3300049585 Bacteria 2574
160 Ga0501070_0084481 3300049586 Bacteria 2628
161 Ga0501070_0228075 3300049586 Bacteria 1526
162 Ga0501071_0042033 3300049587 Bacteria 3273
163 Ga0501072_0164087 3300049588 Bacteria 1772
164 Ga0501073_0053140 3300049589 Bacteria 2836
165 Ga0501074_0176957 3300049590 Bacteria 1522
166 Ga0501075_0011298 3300049591 Bacteria 6318
167 Ga0501076_0002645 3300049592 Bacteria 12359
168 Ga0501079_0145832 3300049741 Bacteria 1844
169 Ga0501080_0145404 3300049742 Bacteria 2191
170 Ga0501080_1052998 3300049742 Bacteria 704
171 Ga0501081_0001859 3300049743 Bacteria 13109
172 Ga0501083_0080047 3300049744 Bacteria 2167
173 Ga0501083_0524129 3300049744 Bacteria 771
174 Ga0501035_0136729 3300049822 Bacteria 2133
175 Ga0501035_0277093 3300049822 Bacteria 1418
176 Ga0501045_0153043 3300049824 Bacteria 1716
177 Ga0501284_03205 3300050005 Bacteria 911
178 nmdc:mga03683_160010_c1 3300050489 Bacteria 1020
179 nmdc:mga00v17_557720_c1 3300050491 Bacteria 740
180 nmdc:mga0yw44_783067_c1 3300050492 Bacteria 648
181 nmdc:mga0k408_251765_c1 3300050493 Bacteria 1055
182 nmdc:mga0qj67_443033_c1 3300050509 Bacteria 1046
183 nmdc:mga06r32_565467_c1 3300050510 Bacteria 1110
184 Ga0495601_0038309 3300053077 Bacteria 2998
185 Ga0500634_0185509 3300053161 Bacteria 930
186 Ga0500601_003573 3300053737 Bacteria 1686
187 Ga0501084_0004138 3300054114 Bacteria 11822
188 Ga0587115_022868 3300059626 Bacteria 883
189 Ga0501082_0003956 3300060353 Bacteria 12933
190 Ga0501082_0622250 3300060353 Bacteria 945
191 Ga0530510_0003620 3300061734 Bacteria 10631
192 2852682013 2852680915 Bacteria 4100189
193 Ga0070665_100171300
194 JGI25153J46596_10003325
195 Ga0055526_1038435
196 Ga0055536_1000651
197 Ga0055536_1010149
198 Ga0055534_1003312
199 Ga0055534_1004579
200 Ga0055530_10000149
201 Ga0055530_10002044
202 Ga0055531_10018894
203 Ga0065165_1008317
204 Ga0065715_10105059
205 Ga0070670_100272808
206 Ga0068869_100228006
207 Ga0070661_100016061
208 Ga0070661_100697546
209 Ga0070713_100231234
210 Ga0070694_100390391
211 Ga0070678_100247562
212 Ga0070679_100262113
213 Ga0070684_100054998
214 Ga0070665_100115730
215 Ga0068855_100085117
216 Ga0068855_100273197
217 Ga0070664_100080406
218 Ga0070664_100687874
219 Ga0068856_100017121
220 Ga0068852_100007211
221 Ga0068862_100348343
222 Ga0075365_10308395
223 Ga0075365_10361475
224 Ga0075364_10165138
225 Ga0070716_100665181
226 Ga0075362_10144470
227 Ga0075366_10266293
228 Ga0075370_10383493
229 Ga0075431_100651420
230 Ga0075434_100518678
231 Ga0105238_10095391
232 Ga0105239_10075330
233 Ga0105239_10536953
234 Ga0157371_10476669
235 Ga0157369_10195057
236 Ga0157369_10222704
237 Ga0157374_10208109
238 Ga0157372_10148258
239 Ga0157372_10544331
240 Ga0163163_10011142
241 Ga0163163_11362648
242 Ga0157379_10074696
243 Ga0157376_10045938
244 Ga0197907_10382908
245 Ga0206353_10198323
246 Ga0206353_10758357
247 Ga0213875_10008507
248 Ga0224712_10019250
249 Ga0209675_1000037
250 Ga0209675_1000135
251 Ga0209676_1000019
252 Ga0209676_1000227
253 Ga0209676_1001265
254 Ga0209676_1002780
255 Ga0209676_1003054
256 Ga0209564_1012275
257 Ga0209758_1000021
258 Ga0209050_1000068
259 Ga0209050_1000798
260 Ga0209050_1010069
261 Ga0209050_1013690
262 Ga0209257_1000768
263 Ga0209257_1001030
264 Ga0209257_1005174
265 Ga0209257_1008988
266 Ga0207692_10150311
267 Ga0207647_10006148
268 Ga0207647_10121404
269 Ga0207705_10293859
270 Ga0207654_10440332
271 Ga0207693_10163388
272 Ga0207660_10508317
273 Ga0207657_10430221
274 Ga0207649_10050381
275 Ga0207649_10791651
276 Ga0207652_11270827
277 Ga0207690_10162363
278 Ga0207706_10306569
279 Ga0207679_10121438
280 Ga0207667_10133970
281 Ga0207640_10023179
282 Ga0207703_10370885
283 Ga0207639_10274372
284 Ga0207702_10014361
285 Ga0207698_10108265
286 Ga0207698_11660048
287 Ga0209371_1000449
288 Ga0268266_10119251
289 Ga0268265_10777802
290 Ga0268256_1003131
291 Ga0316576_10085066
292 Ga0307413_10059836
293 Ga0307409_100921638
294 Ga0307414_10090900
295 Ga0307411_10048291
296 Ga0307415_101336286
297 Ga0316584_0246280
298 Ga0395899_0011215
299 Ga0395899_0014303
300 Ga0395900_0018165
301 Ga0395900_0033116
302 Ga0395898_0002450
303 Ga0395898_0115699
304 Ga0395901_0016298
305 Ga0395901_0214865
306 Ga0451576_0199380
307 Ga0495645_0194885
308 Ga0495625_0493657
309 Ga0496100_0145271
310 Ga0496101_0204210
311 Ga0496102_0093860
312 Ga0496102_0375589
313 Ga0496103_0551025
314 Ga0496104_0004739
315 Ga0496104_0006343
316 Ga0496105_0277777
317 Ga0496106_0070150
318 Ga0496108_0030183
319 Ga0496109_0038184
320 Ga0496112_0812283
321 Ga0496113_0036327
322 Ga0496114_0399178
323 Ga0496115_0102001
324 Ga0496115_0539559
325 Ga0496116_0242936
326 Ga0496118_0405737
327 Ga0496120_0169833
328 Ga0496121_0000612
329 Ga0496121_0037385
330 Ga0496121_0207452
331 Ga0496122_0009453
332 Ga0496122_0012015
333 Ga0496122_0211912
334 Ga0496123_0181880
335 Ga0496123_0244768
336 Ga0496126_0020616
337 Ga0496126_0121756
338 Ga0496126_0124782
339 Ga0496126_0152755
340 Ga0496126_0184006
341 Ga0496126_0406486
342 Ga0501031_0263029
343 Ga0501034_0126455
344 Ga0501036_0018531
345 Ga0501036_0245528
346 Ga0501037_0364535
347 Ga0501040_0221095
348 Ga0501042_0048741
349 Ga0501043_0077090
350 Ga0501046_0069425
351 Ga0501069_0040552
352 Ga0501070_0084481
353 Ga0501070_0228075
354 Ga0501071_0042033
355 Ga0501072_0164087
356 Ga0501073_0053140
357 Ga0501074_0176957
358 Ga0501075_0011298
359 Ga0501076_0002645
360 Ga0501079_0145832
361 Ga0501080_0145404
362 Ga0501080_1052998
363 Ga0501081_0001859
364 Ga0501083_0080047
365 Ga0501083_0524129
366 Ga0501035_0136729
367 Ga0501035_0277093
368 Ga0501045_0153043
369 Ga0501284_03205
370 nmdc:mga03683_160010_c1
371 nmdc:mga00v17_557720_c1
372 nmdc:mga0yw44_783067_c1
373 nmdc:mga0k408_251765_c1
374 nmdc:mga0qj67_443033_c1
375 nmdc:mga06r32_565467_c1
376 Ga0495601_0038309
377 Ga0500634_0185509
378 Ga0500601_003573
379 Ga0501084_0004138
380 Ga0587115_022868
381 Ga0501082_0003956
382 Ga0501082_0622250
383 Ga0530510_0003620
384 2852682013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

8

176

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9799 7 173
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.9798 7 173
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9774 5 173
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.9714 7 173
2vrn-assembly1.cif.gz_B the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily 0.9682 3 183
ID Description Score Start End Superfamily
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9798 7 173 3.40.50.880
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.961 3 183 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9509 7 173 3.40.50.880
4y1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9461 6 176 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9426 3 178 3.40.50.880
ID Description Score Start End GO Terms
AF-D4T8K9-F1-model_v4 deleted 0.9991 78 173
AF-A0A7W6EWW7-F1-model_v4 Protease I (EC 3.2.-.-) 0.997 6 173 GO:0006508
GO:0008233
GO:0016798
AF-A0A0H0XSF1-F1-model_v4 Glutamine amidotransferase 0.9963 6 177 GO:0016740
AF-A0A345ZPD7-F1-model_v4 Type 1 glutamine amidotransferase 0.9963 6 171 GO:0016740
AF-A0A6I4SZU7-F1-model_v4 DJ-1/PfpI/YhbO family deglycase/protease 0.9958 7 177 GO:0006508
GO:0008233

Map