F295296

General Info

Members Datasets Scaffolds Average Seq Length
192 151 384 244

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100413244|Ga0070698_1004132441
Length 275
Sequence MVPYSTTDSSEDRRGWVRTFLRVSASDWFDLSGQVAVVTGARRGIGRGIAVGLARAGADIVVVSRTAAEDVAAEIERLGRRSIPIAADLAHREQVARVIPEAVRSLGRVDILVNNAGVTTRSPALDVTLEDWHRVLQVNLHAVFTLCQDAARDMVPRGRGKIINIASLMSFQGGVLIAAYTASKGAVAQLTKLLANEWAGQGINVNAIVPGYIATDLTRPLQEDAVRNPAILARIPAGRWGRPDDLAGAAVFLASKASDYVHGHLLAVDGGWLAR

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
22 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
23 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
47 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
55 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
56 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
57 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
67 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
68 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
69 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
91 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
92 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
93 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
94 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
95 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
96 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
97 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
98 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
99 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
102 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
105 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
116 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
117 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
128 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
137 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
138 2643221645 Massilia sp. Root351 Isolate Unclassified
139 2643221664 Massilia sp. Root418 Isolate Unclassified
140 2738541280 Massilia sp. GV090 Isolate Unclassified
141 2738541300 Massilia sp. GV016 Isolate Unclassified
142 2738543018 Massilia sp. GV045 Isolate Unclassified
143 2738543030 Massilia sp. GV097 Isolate Unclassified
144 2818991441 Niallia circulans 3243 Isolate Rhizosphere
145 2904424332 Duganella sp. 1411 Isolate Rhizosphere
146 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
147 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
148 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
149 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
150 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
151 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.71
Metatranscriptomes 0
Isolates 7.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 1.56
Rhizoplane 3.65
Rhizosphere 85.42
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100413244 3300005471 Bacteria 1283
2 JGI24739J22299_10001018 3300001989 Bacteria 10408
3 JGI25406J46586_10000804 3300003203 Bacteria 14823
4 Ga0070658_10620514 3300005327 Bacteria 938
5 Ga0070666_10022933 3300005335 Bacteria 4058
6 Ga0070680_100079821 3300005336 Bacteria 2697
7 Ga0070660_100015374 3300005339 Bacteria 5523
8 Ga0070661_100012297 3300005344 Bacteria 5985
9 Ga0070659_100057572 3300005366 Bacteria 3065
10 Ga0070694_100031090 3300005444 Bacteria 3498
11 Ga0070706_100116603 3300005467 Bacteria 2487
12 Ga0070707_100029274 3300005468 Bacteria 5244
13 Ga0070707_100082408 3300005468 Bacteria 3107
14 Ga0070698_100218512 3300005471 Bacteria 1840
15 Ga0068855_100131602 3300005563 Bacteria 2857
16 Ga0070664_100092967 3300005564 Bacteria 2612
17 Ga0068858_100011630 3300005842 Bacteria 8302
18 Ga0081539_10001051 3300005985 Bacteria 50562
19 Ga0075362_10184347 3300006177 Bacteria 1012
20 Ga0075430_100103651 3300006846 Bacteria 2375
21 Ga0075433_10509634 3300006852 Bacteria 1059
22 Ga0068865_100299876 3300006881 Bacteria 1286
23 Ga0099826_10000001 3300006948 Bacteria 1155201
24 Ga0105251_10007253 3300009011 Bacteria 6873
25 Ga0105250_10031918 3300009092 Unclassified 2115
26 Ga0105245_10067388 3300009098 Bacteria 3242
27 Ga0105247_10007306 3300009101 Bacteria 6788
28 Ga0114129_10000006 3300009147 Bacteria 157531
29 Ga0114129_10025036 3300009147 Bacteria 8460
30 Ga0105248_10066592 3300009177 Bacteria 4044
31 Ga0157371_10094825 3300013102 Bacteria 2115
32 Ga0163163_10337685 3300014325 Bacteria 1562
33 Ga0163163_10574753 3300014325 Bacteria 1190
34 Ga0157380_10059640 3300014326 Bacteria 3046
35 Ga0209676_1000256 3300025292 Bacteria 112819
36 Ga0209050_1025518 3300025298 Bacteria 2005
37 Ga0207713_1008716 3300025735 Bacteria 5792
38 Ga0207710_10012170 3300025900 Bacteria 3618
39 Ga0207705_10272025 3300025909 Bacteria 1295
40 Ga0207657_10006839 3300025919 Bacteria 11766
41 Ga0207649_10079963 3300025920 Bacteria 2113
42 Ga0207646_10025096 3300025922 Bacteria 5455
43 Ga0207687_10040603 3300025927 Bacteria 3190
44 Ga0207706_10266470 3300025933 Bacteria 1495
45 Ga0207704_10245013 3300025938 Bacteria 1342
46 Ga0207679_10813011 3300025945 Bacteria 852
47 Ga0207667_10046098 3300025949 Bacteria 4616
48 Ga0207667_10064608 3300025949 Bacteria 3819
49 Ga0207703_10169495 3300026035 Bacteria 1919
50 Ga0207648_10292357 3300026089 Bacteria 1459
51 Ga0207648_10891897 3300026089 Bacteria 830
52 Ga0209282_1000001 3300027666 Bacteria 2450367
53 Ga0209588_1049569 3300027671 Bacteria 1359
54 Ga0207428_10031654 3300027907 Bacteria 4361
55 Ga0314311_1105074 3300030733 Bacteria 1579
56 Ga0265325_10038475 3300031241 Bacteria 2524
57 Ga0265331_10058600 3300031250 Bacteria 1823
58 Ga0265316_10014359 3300031344 Bacteria 6975
59 Ga0307513_10040141 3300031456 Bacteria 5177
60 Ga0316579_10130254 3300031691 Bacteria 1212
61 Ga0265342_10108888 3300031712 Bacteria 1570
62 Ga0316578_10327445 3300031728 Bacteria 914
63 Ga0316577_10015807 3300031733 Bacteria 4153
64 Ga0307416_100397910 3300032002 Bacteria 1414
65 Ga0373954_0045588 3300035118 Bacteria 2049
66 Ga0373925_0159507 3300037068 Bacteria 1776
67 Ga0395899_0000012 3300037312 Bacteria 517561
68 Ga0395899_0002407 3300037312 Bacteria 15204
69 Ga0395899_0016115 3300037312 Bacteria 5698
70 Ga0395899_0073557 3300037312 Bacteria 2498
71 Ga0395899_0224016 3300037312 Bacteria 1301
72 Ga0395900_0002683 3300037418 Bacteria 19454
73 Ga0395900_0003216 3300037418 Bacteria 17685
74 Ga0395900_0064343 3300037418 Bacteria 3769
75 Ga0395898_0019762 3300037466 Bacteria 6850
76 Ga0395898_0512747 3300037466 Bacteria 1140
77 Ga0395905_0076351 3300037471 Bacteria 3140
78 Ga0395905_0262697 3300037471 Bacteria 1611
79 Ga0395905_0417016 3300037471 Bacteria 1238
80 Ga0395901_0151064 3300038443 Bacteria 2440
81 Ga0395901_0384752 3300038443 Bacteria 1443
82 Ga0400490_14639 3300038726 Bacteria 23628
83 Ga0439447_002902 3300041407 Bacteria 6139
84 Ga0439448_0001122 3300042005 Bacteria 6753
85 Ga0450920_060206 3300042122 Bacteria 766
86 Ga0466965_0005739 3300044683 Bacteria 5601
87 Ga0466965_0165714 3300044683 Bacteria 1160
88 Ga0466966_0001407 3300044684 Bacteria 15484
89 Ga0466966_0013050 3300044684 Bacteria 5500
90 Ga0466966_0142094 3300044684 Bacteria 1466
91 Ga0466961_0053821 3300044693 Bacteria 2567
92 Ga0466961_0237629 3300044693 Bacteria 1120
93 Ga0466963_0339649 3300044694 Bacteria 1057
94 Ga0466964_0000150 3300044706 Bacteria 18826
95 Ga0466971_0163009 3300044719 Bacteria 1044
96 Ga0466968_0114997 3300044735 Bacteria 1213
97 Ga0466957_0000034 3300044842 Bacteria 48746
98 Ga0451576_0362566 3300045051 Bacteria 1518
99 Ga0451576_1469249 3300045051 Bacteria 708
100 Ga0466958_0080098 3300045836 Bacteria 2009
101 Ga0495590_0000003 3300046457 Bacteria 478593
102 Ga0495638_0000198 3300046460 Bacteria 86199
103 Ga0495638_0002732 3300046460 Bacteria 14178
104 Ga0495650_0000577 3300046471 Bacteria 51317
105 Ga0495605_0001495 3300046474 Bacteria 15232
106 Ga0495639_0002680 3300046475 Bacteria 7733
107 Ga0495584_0000229 3300046491 Bacteria 40347
108 Ga0495585_0019583 3300046492 Bacteria 3901
109 Ga0495607_0035808 3300046501 Bacteria 2998
110 Ga0495583_0000253 3300046506 Bacteria 88398
111 Ga0495583_0000265 3300046506 Bacteria 86085
112 Ga0495610_0001501 3300046512 Bacteria 20517
113 Ga0495616_0000283 3300046513 Bacteria 41076
114 Ga0495643_0000106 3300046522 Bacteria 138657
115 Ga0495643_0000621 3300046522 Bacteria 42290
116 Ga0495644_0017977 3300046523 Bacteria 2700
117 Ga0495648_0000087 3300046524 Bacteria 116394
118 Ga0495648_0000238 3300046524 Bacteria 63006
119 Ga0495642_0005083 3300046528 Bacteria 5065
120 Ga0495654_0026485 3300046530 Bacteria 2980
121 Ga0495609_0000241 3300046538 Bacteria 52185
122 Ga0495597_0000119 3300046542 Bacteria 71150
123 Ga0495597_0000243 3300046542 Bacteria 49541
124 Ga0495622_0000084 3300046557 Bacteria 83759
125 Ga0495633_0000187 3300046558 Bacteria 80958
126 Ga0495633_0000767 3300046558 Bacteria 28845
127 Ga0495656_0005629 3300046615 Bacteria 4335
128 Ga0495668_0000239 3300046616 Bacteria 78426
129 Ga0495611_0073262 3300046648 Bacteria 1567
130 Ga0495625_0000038 3300046660 Bacteria 211808
131 Ga0495625_0001665 3300046660 Bacteria 26013
132 Ga0495625_0063503 3300046660 Bacteria 2607
133 Ga0495625_0079340 3300046660 Bacteria 2289
134 Ga0495659_0001060 3300046664 Bacteria 9607
135 Ga0495661_0010282 3300046665 Bacteria 6391
136 Ga0495588_0000041 3300046674 Bacteria 377896
137 Ga0495670_0000114 3300046691 Bacteria 35822
138 Ga0495670_0131664 3300046691 Bacteria 1304
139 Ga0495670_0282947 3300046691 Bacteria 887
140 Ga0495671_0008482 3300046692 Bacteria 5778
141 Ga0495671_0020050 3300046692 Bacteria 3527
142 Ga0495649_0006606 3300046694 Bacteria 7212
143 Ga0495660_0002719 3300046810 Bacteria 11167
144 Ga0495636_0000720 3300047318 Bacteria 12107
145 Ga0495672_0000141 3300047320 Bacteria 106630
146 Ga0495672_0000264 3300047320 Bacteria 72738
147 Ga0495672_0018604 3300047320 Bacteria 4605
148 Ga0495683_0003920 3300047323 Bacteria 8558
149 Ga0495687_000062 3300047443 Bacteria 176135
150 Ga0495687_000254 3300047443 Bacteria 71880
151 Ga0495687_003359 3300047443 Bacteria 11679
152 Ga0495685_000658 3300047447 Bacteria 10556
153 Ga0495673_0000024 3300047469 Bacteria 521349
154 Ga0495673_0000785 3300047469 Bacteria 29990
155 Ga0495626_0090567 3300048091 Bacteria 1345
156 Ga0496103_0002191 3300048906 Bacteria 12399
157 Ga0496106_0000037 3300048909 Bacteria 116951
158 Ga0496108_0027521 3300048911 Bacteria 4696
159 Ga0496109_0230013 3300048912 Bacteria 1744
160 Ga0496111_0085613 3300048914 Bacteria 2305
161 Ga0496112_0022666 3300048915 Bacteria 5988
162 Ga0496114_0621067 3300048917 Bacteria 952
163 Ga0496122_0001165 3300048925 Bacteria 44919
164 Ga0496124_0010055 3300048927 Bacteria 9650
165 Ga0495678_000101 3300049459 Bacteria 104596
166 Ga0495678_000663 3300049459 Bacteria 31565
167 Ga0495678_005468 3300049459 Bacteria 7002
168 Ga0495682_0000208 3300049460 Bacteria 47163
169 Ga0501070_0227262 3300049586 Bacteria 1530
170 Ga0501070_0274634 3300049586 Bacteria 1376
171 Ga0501083_0008378 3300049744 Bacteria 7311
172 nmdc:mga03683_101364_c1 3300050489 Bacteria 1265
173 nmdc:mga05p37_25_c1 3300050507 Bacteria 116982
174 nmdc:mga08y16_158993_c1 3300050511 Bacteria 2348
175 nmdc:mga0n895_64581_c1 3300050512 Bacteria 3621
176 nmdc:mga08x19_425272_c1 3300050514 Bacteria 933
177 Ga0500604_0127009 3300053151 Bacteria 856
178 Ga0466962_0205626 3300061719 Bacteria 962
179 2644250280 2643221645 Bacteria 7207331
180 2644357735 2643221664 Bacteria 7272945
181 2738741693 2738541280 Bacteria 6630198
182 2738843989 2738541300 Bacteria 6675882
183 2739274447 2738543018 Bacteria 6718814
184 2739343491 2738543030 Bacteria 6719714
185 2819569119 2818991441 Bacteria 5062707
186 2904429706 2904424332 Bacteria 7633521
187 2977259386 2977254563 Bacteria 4828420
188 2990280432 2990275345 Bacteria 4887158
189 3006828500 3006826541 Bacteria 4678913
190 3006971202 3006969106 Bacteria 4739423
191 8053953437 8053945823 Bacteria 8962862
192 8054797028 8054795415 Bacteria 9785225
193 Ga0070698_100413244
194 JGI24739J22299_10001018
195 JGI25406J46586_10000804
196 Ga0070658_10620514
197 Ga0070666_10022933
198 Ga0070680_100079821
199 Ga0070660_100015374
200 Ga0070661_100012297
201 Ga0070659_100057572
202 Ga0070694_100031090
203 Ga0070706_100116603
204 Ga0070707_100029274
205 Ga0070707_100082408
206 Ga0070698_100218512
207 Ga0068855_100131602
208 Ga0070664_100092967
209 Ga0068858_100011630
210 Ga0081539_10001051
211 Ga0075362_10184347
212 Ga0075430_100103651
213 Ga0075433_10509634
214 Ga0068865_100299876
215 Ga0099826_10000001
216 Ga0105251_10007253
217 Ga0105250_10031918
218 Ga0105245_10067388
219 Ga0105247_10007306
220 Ga0114129_10000006
221 Ga0114129_10025036
222 Ga0105248_10066592
223 Ga0157371_10094825
224 Ga0163163_10337685
225 Ga0163163_10574753
226 Ga0157380_10059640
227 Ga0209676_1000256
228 Ga0209050_1025518
229 Ga0207713_1008716
230 Ga0207710_10012170
231 Ga0207705_10272025
232 Ga0207657_10006839
233 Ga0207649_10079963
234 Ga0207646_10025096
235 Ga0207687_10040603
236 Ga0207706_10266470
237 Ga0207704_10245013
238 Ga0207679_10813011
239 Ga0207667_10046098
240 Ga0207667_10064608
241 Ga0207703_10169495
242 Ga0207648_10292357
243 Ga0207648_10891897
244 Ga0209282_1000001
245 Ga0209588_1049569
246 Ga0207428_10031654
247 Ga0314311_1105074
248 Ga0265325_10038475
249 Ga0265331_10058600
250 Ga0265316_10014359
251 Ga0307513_10040141
252 Ga0316579_10130254
253 Ga0265342_10108888
254 Ga0316578_10327445
255 Ga0316577_10015807
256 Ga0307416_100397910
257 Ga0373954_0045588
258 Ga0373925_0159507
259 Ga0395899_0000012
260 Ga0395899_0002407
261 Ga0395899_0016115
262 Ga0395899_0073557
263 Ga0395899_0224016
264 Ga0395900_0002683
265 Ga0395900_0003216
266 Ga0395900_0064343
267 Ga0395898_0019762
268 Ga0395898_0512747
269 Ga0395905_0076351
270 Ga0395905_0262697
271 Ga0395905_0417016
272 Ga0395901_0151064
273 Ga0395901_0384752
274 Ga0400490_14639
275 Ga0439447_002902
276 Ga0439448_0001122
277 Ga0450920_060206
278 Ga0466965_0005739
279 Ga0466965_0165714
280 Ga0466966_0001407
281 Ga0466966_0013050
282 Ga0466966_0142094
283 Ga0466961_0053821
284 Ga0466961_0237629
285 Ga0466963_0339649
286 Ga0466964_0000150
287 Ga0466971_0163009
288 Ga0466968_0114997
289 Ga0466957_0000034
290 Ga0451576_0362566
291 Ga0451576_1469249
292 Ga0466958_0080098
293 Ga0495590_0000003
294 Ga0495638_0000198
295 Ga0495638_0002732
296 Ga0495650_0000577
297 Ga0495605_0001495
298 Ga0495639_0002680
299 Ga0495584_0000229
300 Ga0495585_0019583
301 Ga0495607_0035808
302 Ga0495583_0000253
303 Ga0495583_0000265
304 Ga0495610_0001501
305 Ga0495616_0000283
306 Ga0495643_0000106
307 Ga0495643_0000621
308 Ga0495644_0017977
309 Ga0495648_0000087
310 Ga0495648_0000238
311 Ga0495642_0005083
312 Ga0495654_0026485
313 Ga0495609_0000241
314 Ga0495597_0000119
315 Ga0495597_0000243
316 Ga0495622_0000084
317 Ga0495633_0000187
318 Ga0495633_0000767
319 Ga0495656_0005629
320 Ga0495668_0000239
321 Ga0495611_0073262
322 Ga0495625_0000038
323 Ga0495625_0001665
324 Ga0495625_0063503
325 Ga0495625_0079340
326 Ga0495659_0001060
327 Ga0495661_0010282
328 Ga0495588_0000041
329 Ga0495670_0000114
330 Ga0495670_0131664
331 Ga0495670_0282947
332 Ga0495671_0008482
333 Ga0495671_0020050
334 Ga0495649_0006606
335 Ga0495660_0002719
336 Ga0495636_0000720
337 Ga0495672_0000141
338 Ga0495672_0000264
339 Ga0495672_0018604
340 Ga0495683_0003920
341 Ga0495687_000062
342 Ga0495687_000254
343 Ga0495687_003359
344 Ga0495685_000658
345 Ga0495673_0000024
346 Ga0495673_0000785
347 Ga0495626_0090567
348 Ga0496103_0002191
349 Ga0496106_0000037
350 Ga0496108_0027521
351 Ga0496109_0230013
352 Ga0496111_0085613
353 Ga0496112_0022666
354 Ga0496114_0621067
355 Ga0496122_0001165
356 Ga0496124_0010055
357 Ga0495678_000101
358 Ga0495678_000663
359 Ga0495678_005468
360 Ga0495682_0000208
361 Ga0501070_0227262
362 Ga0501070_0274634
363 Ga0501083_0008378
364 nmdc:mga03683_101364_c1
365 nmdc:mga05p37_25_c1
366 nmdc:mga08y16_158993_c1
367 nmdc:mga0n895_64581_c1
368 nmdc:mga08x19_425272_c1
369 Ga0500604_0127009
370 Ga0466962_0205626
371 2644250280
372 2644357735
373 2738741693
374 2738843989
375 2739274447
376 2739343491
377 2819569119
378 2904429706
379 2977259386
380 2990280432
381 3006828500
382 3006971202
383 8053953437
384 8054797028

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

34

226

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

40

273

0.96

PF08659

KR

KR domain

34

215

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uf0-assembly1.cif.gz_A crystal structure of a putative nad(p) dependent gluconate 5-dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound nadp (low occupancy) 0.9675 5 255
4z9y-assembly1.cif.gz_B crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from pectobacterium carotovorum 0.9671 1 255
4z9y-assembly1.cif.gz_B crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from pectobacterium carotovorum 0.9633 1 255
4jro-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9629 7 252
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9626 7 252
ID Description Score Start End Superfamily
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9711 3 255 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9676 88 252 3.40.50.720
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9636 3 255 3.40.50.720
4hp8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9585 4 255 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9583 96 197 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3N1MZ85-F1-model_v4 deleted 0.9905 4 255
AF-A0A850Z401-F1-model_v4 TRNH9 reductase 0.9867 171 255 GO:0006633
GO:0016616
AF-W1XNE0-F1-model_v4 Gluconate 5-dehydrogenase 0.9851 101 219 GO:0016491
AF-A0A1I6JXE7-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9842 11 255 GO:0016616
AF-A0A3N1MZ85-F1-model_v4 deleted 0.9827 4 255

Map