F294886

General Info

Members Datasets Scaffolds Average Seq Length
191 160 382 382

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8048406513|8048411545
Length 411
Sequence LTCDVVVVGAGMVGAACALYAARAGLGVTVVDRGPVAGGTTGAGEGNLLVSDKEPGPELRLALLSNRLWTDLAAEPGLGTAFEYDPKGGLVVASAPEGLAALEAFAAGQRTAGVAAETVTAGQLRELEPESAPGLAGGVYYPQDAQVMPTLAAAHLVRASRARLLTGRTVTGVLRSRDGAVRGVRTDRGEIHAPAVVNAAGTWGGEVAALAGVHLPVLPRRGFVLVTEPLPPLVRHKVYAADYVADVASDSAALQTSPVVEGTAAGPVLIGASRERVGFDRSFSLPVVRALAAGATRLFPFLERVRAMRTYVGFRPYMPDHLPAIGPDPRVPGLLHACGHEGAGIGLATGTGQLIAQVLDGRTPDLDLTPFRPDRFAPRDEEPGLSGRRFAARDGNPGRRGRFVAHEEEAE

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
8 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
9 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
10 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
11 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
13 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
14 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
17 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
18 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
19 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
20 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
21 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
22 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
23 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
24 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
25 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
26 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
27 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
28 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
29 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
30 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
31 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
32 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
33 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
34 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
35 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
36 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
37 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
38 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
39 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
40 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
41 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
42 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
43 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
44 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
45 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
46 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
47 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
48 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
49 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
50 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
51 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
52 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
53 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
54 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
55 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
56 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
57 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
58 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
59 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
60 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
61 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
62 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
63 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
64 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
65 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
66 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
67 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
68 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
69 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
70 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
71 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
72 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
73 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
74 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
75 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
76 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
77 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
78 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
79 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
80 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
81 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
82 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
83 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
84 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
85 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
86 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
87 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
88 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
89 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
90 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
107 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
110 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
111 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
112 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
113 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
114 2643221578 Streptomyces sp. Root63 Isolate Unclassified
115 2643221647 Streptomyces sp. Root369 Isolate Unclassified
116 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
117 2643221679 Angustibacter sp. Root456 Isolate Unclassified
118 2643221714 Streptomyces sp. Root264 Isolate Unclassified
119 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
120 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
121 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
122 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
123 2808606448 Streptomyces sp. 193411 Isolate Unclassified
124 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
125 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
126 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
127 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
128 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
129 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
130 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
131 2867428634 Streptomyces sp. RP5T Isolate Unclassified
132 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
133 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
134 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
135 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
136 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
137 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
138 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
139 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
140 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
141 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
142 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
143 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
144 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
145 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
146 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
147 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
148 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
149 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
150 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
151 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
152 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
153 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
154 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
155 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
156 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
157 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
158 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
159 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
160 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.77
Metatranscriptomes 0.52
Isolates 26.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 1.05
Rhizoplane 1.57
Rhizosphere 77.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10011773 3300003203 Bacteria 3819
2 JGI25160J50197_1004205 3300003354 Bacteria 6255
3 Ga0006562J51391_1052290 3300003578 Bacteria 2400
4 Ga0070709_10024258 3300005434 Bacteria 3569
5 Ga0070700_100000010 3300005441 Bacteria 176885
6 Ga0081539_10000079 3300005985 Bacteria 223413
7 Ga0075428_100001356 3300006844 Bacteria 25987
8 Ga0075430_100001124 3300006846 Bacteria 21281
9 Ga0075430_100003241 3300006846 Bacteria 13630
10 Ga0075431_100002314 3300006847 Bacteria 18303
11 Ga0075431_100294962 3300006847 Bacteria 1639
12 Ga0075429_100003556 3300006880 Bacteria 13277
13 Ga0114129_10008813 3300009147 Bacteria 14392
14 Ga0183367_1001 3300015688 Bacteria 1225545
15 Ga0207426_1000529 3300025302 Bacteria 55035
16 Ga0207699_10009604 3300025906 Bacteria 4825
17 Ga0207708_10000006 3300026075 Bacteria 266916
18 Ga0307515_10000441 3300028794 Bacteria 99819
19 Ga0307515_10146099 3300028794 Bacteria 2503
20 Ga0307512_10005175 3300030522 Bacteria 13759
21 Ga0307513_10035720 3300031456 Bacteria 5556
22 Ga0307508_10111873 3300031616 Bacteria 2331
23 Ga0307516_10010622 3300031730 Bacteria 10101
24 Ga0307518_10124721 3300031838 Bacteria 1818
25 Ga0307507_10000240 3300033179 Bacteria 106042
26 Ga0307507_10015925 3300033179 Bacteria 8801
27 Ga0307507_10124263 3300033179 Bacteria 2050
28 Ga0307510_10162846 3300033180 Bacteria 1824
29 Ga0436364_1195707 3300037853 Bacteria 3783
30 Ga0439436_0009657 3300041404 Bacteria 2956
31 Ga0439436_0014594 3300041404 Bacteria 2367
32 Ga0439439_0009693 3300041406 Bacteria 2296
33 Ga0451853_3861592 3300041512 Bacteria 2464
34 Ga0439449_0003511 3300042007 Bacteria 6091
35 Ga0439457_001522 3300042014 Bacteria 6960
36 Ga0450894_001215 3300042131 Bacteria 3795
37 Ga0450903_000402 3300042138 Bacteria 9276
38 Ga0450906_000700 3300042145 Bacteria 7190
39 Ga0466969_0001928 3300044656 Bacteria 11079
40 Ga0466969_0023553 3300044656 Bacteria 3172
41 Ga0466969_0046647 3300044656 Bacteria 2147
42 Ga0466969_0047757 3300044656 Bacteria 2118
43 Ga0466972_0004674 3300044658 Bacteria 6856
44 Ga0466972_0031702 3300044658 Bacteria 2598
45 Ga0466965_0002520 3300044683 Bacteria 7807
46 Ga0466966_0007385 3300044684 Bacteria 7289
47 Ga0466966_0012226 3300044684 Bacteria 5687
48 Ga0466966_0017383 3300044684 Bacteria 4753
49 Ga0466966_0028245 3300044684 Bacteria 3655
50 Ga0466966_0110959 3300044684 Bacteria 1690
51 Ga0466961_0008124 3300044693 Bacteria 6681
52 Ga0466961_0009249 3300044693 Bacteria 6274
53 Ga0466961_0049116 3300044693 Bacteria 2697
54 Ga0466963_0002162 3300044694 Bacteria 10860
55 Ga0466964_0000321 3300044706 Bacteria 14261
56 Ga0466971_0001426 3300044719 Bacteria 10041
57 Ga0466968_0018463 3300044735 Bacteria 2798
58 Ga0466970_0001771 3300044765 Bacteria 10408
59 Ga0466957_0000206 3300044842 Bacteria 27538
60 Ga0466959_0004074 3300045049 Bacteria 9724
61 Ga0466959_0006147 3300045049 Bacteria 8296
62 Ga0466959_0020032 3300045049 Bacteria 4924
63 Ga0466959_0065633 3300045049 Bacteria 2634
64 Ga0466958_0034228 3300045836 Bacteria 3030
65 Ga0466958_0089259 3300045836 Bacteria 1905
66 Ga0466967_0000619 3300045976 Bacteria 17708
67 Ga0466967_0059357 3300045976 Bacteria 3386
68 Ga0495592_0002483 3300046454 Bacteria 13033
69 Ga0495590_0035791 3300046457 Bacteria 1733
70 Ga0495629_0018246 3300046459 Bacteria 5025
71 Ga0495638_0092801 3300046460 Bacteria 1817
72 Ga0495651_0003430 3300046462 Bacteria 12161
73 Ga0495605_0005955 3300046474 Bacteria 7051
74 Ga0495662_0000269 3300046476 Bacteria 22106
75 Ga0495664_0010838 3300046477 Bacteria 5125
76 Ga0495594_0018588 3300046499 Bacteria 3683
77 Ga0495606_0017990 3300046507 Bacteria 5317
78 Ga0495610_0012672 3300046512 Bacteria 5055
79 Ga0495616_0001838 3300046513 Bacteria 14375
80 Ga0495620_0016263 3300046515 Bacteria 3739
81 Ga0495628_0045678 3300046516 Bacteria 3481
82 Ga0495630_0003162 3300046517 Bacteria 11431
83 Ga0495631_0062423 3300046518 Bacteria 1614
84 Ga0495643_0058214 3300046522 Bacteria 2057
85 Ga0495666_0025548 3300046526 Bacteria 2916
86 Ga0495652_0020898 3300046529 Bacteria 5817
87 Ga0495640_0013810 3300046533 Bacteria 6134
88 Ga0495640_0085567 3300046533 Bacteria 2089
89 Ga0495587_0002745 3300046536 Bacteria 11739
90 Ga0495645_0067307 3300046543 Bacteria 2586
91 Ga0495667_0022640 3300046559 Bacteria 4233
92 Ga0495668_0009851 3300046616 Bacteria 5830
93 Ga0495634_0004250 3300046642 Bacteria 11292
94 Ga0495625_0043755 3300046660 Bacteria 3245
95 Ga0495635_0006861 3300046663 Bacteria 7955
96 Ga0495588_0003867 3300046674 Bacteria 6562
97 Ga0495599_0006003 3300046678 Bacteria 7307
98 Ga0495623_0002580 3300046679 Bacteria 11971
99 Ga0495646_0000765 3300046680 Bacteria 17921
100 Ga0495646_0004089 3300046680 Bacteria 9152
101 Ga0495671_0012040 3300046692 Bacteria 4732
102 Ga0495589_0001676 3300046794 Bacteria 12681
103 Ga0495589_0015143 3300046794 Bacteria 3971
104 Ga0495589_0057111 3300046794 Bacteria 1920
105 Ga0495600_0002374 3300046809 Bacteria 10763
106 Ga0495600_0029488 3300046809 Bacteria 3552
107 Ga0495604_0004530 3300047317 Bacteria 11008
108 Ga0495674_0013220 3300047319 Bacteria 7759
109 Ga0495676_0011089 3300047321 Bacteria 8144
110 Ga0495676_0035173 3300047321 Bacteria 4192
111 Ga0495687_016099 3300047443 Bacteria 3771
112 Ga0495675_0002441 3300047444 Bacteria 11115
113 Ga0495685_004732 3300047447 Bacteria 4416
114 Ga0495685_004884 3300047447 Bacteria 4352
115 Ga0495684_0004401 3300047471 Bacteria 11008
116 Ga0495686_0081062 3300047472 Bacteria 1982
117 Ga0495602_0005444 3300048088 Bacteria 13353
118 Ga0495626_0012780 3300048091 Bacteria 4386
119 Ga0496105_0098450 3300048908 Bacteria 2415
120 Ga0496108_0069150 3300048911 Bacteria 2980
121 Ga0496109_0040748 3300048912 Bacteria 4207
122 Ga0501032_0114239 3300049569 Bacteria 1786
123 Ga0501034_0017540 3300049571 Bacteria 7342
124 Ga0501036_0003066 3300049572 Bacteria 13318
125 Ga0501037_0066598 3300049573 Bacteria 2623
126 Ga0501038_0045709 3300049574 Bacteria 3799
127 Ga0501039_0077085 3300049575 Bacteria 2592
128 Ga0501042_0011558 3300049578 Bacteria 5959
129 Ga0501043_0001197 3300049579 Bacteria 22839
130 Ga0501047_0001445 3300049581 Bacteria 23262
131 Ga0501074_0007866 3300049590 Bacteria 7720
132 Ga0501044_0014865 3300049823 Bacteria 8391
133 nmdc:mga05p37_672_c1 3300050507 Bacteria 37785
134 nmdc:mga09592_2964_c1 3300050508 Bacteria 13758
135 nmdc:mga0qj67_11814_c1 3300050509 Bacteria 6555
136 nmdc:mga0qj67_294_c1 3300050509 Bacteria 34748
137 nmdc:mga06r32_285_c2 3300050510 Bacteria 37898
138 nmdc:mga06r32_356898_c1 3300050510 Bacteria 1446
139 Ga0466962_0000253 3300061719 Bacteria 22558
140 Ga0466962_0007523 3300061719 Bacteria 5225
141 8048411545 8048406513 Bacteria 8936924
142 2547412729 2547132111 Bacteria 8013147
143 2558907116 2558860112 Bacteria 9931328
144 2585309361 2582581313 Bacteria 10042643
145 2643904339 2643221578 Bacteria 9213798
146 2644264661 2643221647 Bacteria 10741251
147 2644402692 2643221673 Bacteria 9196637
148 2644447220 2643221679 Bacteria 3839507
149 2644631218 2643221714 Bacteria 9015452
150 2784591409 2784132148 Bacteria 8627943
151 2785339729 2784746763 Bacteria 9783172
152 2786673538 2786546132 Bacteria 10419719
153 2808845122 2808606359 Bacteria 9866990
154 2809235011 2808606448 Bacteria 8656184
155 2812354498 2811994879 Bacteria 9313447
156 2812477304 2811994917 Bacteria 7761064
157 2852636116 2852635781 Bacteria 8251373
158 2862182057 2862178590 Bacteria 8583590
159 2862284054 2862281513 Bacteria 9621493
160 2862388719 2862382967 Bacteria 10317375
161 2863410279 2863404153 Bacteria 9672205
162 2867437909 2867428634 Bacteria 9590268
163 2895430750 2895427314 Bacteria 13147766
164 2912716887 2912715099 Bacteria 9460473
165 2935391092 2935390628 Bacteria 7043367
166 2946047316 2946045630 Bacteria 8527308
167 2946071205 2946064051 Bacteria 8957905
168 2946078994 2946072368 Bacteria 8999607
169 2947225548 2947224130 Bacteria 9938529
170 2954010533 2954002825 Bacteria 9173742
171 2954383147 2954380949 Bacteria 10050426
172 2954679844 2954673503 Bacteria 9685905
173 2954684309 2954682443 Bacteria 9862841
174 2954693859 2954691527 Bacteria 10720516
175 2954708970 2954701450 Bacteria 10834262
176 2954723455 2954721474 Bacteria 10456478
177 2954738375 2954731030 Bacteria 10243860
178 2954742359 2954740390 Bacteria 10229294
179 2954757236 2954749733 Bacteria 10366972
180 2954761329 2954759201 Bacteria 9358192
181 2990067032 2990059506 Bacteria 9321252
182 2995469377 2995463766 Bacteria 8577691
183 2997601255 2997600082 Bacteria 9896405
184 3006493206 3006486233 Bacteria 8157040
185 8008564275 8008558824 Bacteria 10610750
186 8023630332 8023623736 Bacteria 8593882
187 8025484983 8025478263 Bacteria 8209203
188 8054165901 8054160619 Bacteria 7783213
189 8055068626 8055066027 Bacteria 9479577
190 8056832701 8056829672 Bacteria 9045328
191 8057572501 8057568493 Bacteria 7221719
192 JGI25406J46586_10011773
193 JGI25160J50197_1004205
194 Ga0006562J51391_1052290
195 Ga0070709_10024258
196 Ga0070700_100000010
197 Ga0081539_10000079
198 Ga0075428_100001356
199 Ga0075430_100001124
200 Ga0075430_100003241
201 Ga0075431_100002314
202 Ga0075431_100294962
203 Ga0075429_100003556
204 Ga0114129_10008813
205 Ga0183367_1001
206 Ga0207426_1000529
207 Ga0207699_10009604
208 Ga0207708_10000006
209 Ga0307515_10000441
210 Ga0307515_10146099
211 Ga0307512_10005175
212 Ga0307513_10035720
213 Ga0307508_10111873
214 Ga0307516_10010622
215 Ga0307518_10124721
216 Ga0307507_10000240
217 Ga0307507_10015925
218 Ga0307507_10124263
219 Ga0307510_10162846
220 Ga0436364_1195707
221 Ga0439436_0009657
222 Ga0439436_0014594
223 Ga0439439_0009693
224 Ga0451853_3861592
225 Ga0439449_0003511
226 Ga0439457_001522
227 Ga0450894_001215
228 Ga0450903_000402
229 Ga0450906_000700
230 Ga0466969_0001928
231 Ga0466969_0023553
232 Ga0466969_0046647
233 Ga0466969_0047757
234 Ga0466972_0004674
235 Ga0466972_0031702
236 Ga0466965_0002520
237 Ga0466966_0007385
238 Ga0466966_0012226
239 Ga0466966_0017383
240 Ga0466966_0028245
241 Ga0466966_0110959
242 Ga0466961_0008124
243 Ga0466961_0009249
244 Ga0466961_0049116
245 Ga0466963_0002162
246 Ga0466964_0000321
247 Ga0466971_0001426
248 Ga0466968_0018463
249 Ga0466970_0001771
250 Ga0466957_0000206
251 Ga0466959_0004074
252 Ga0466959_0006147
253 Ga0466959_0020032
254 Ga0466959_0065633
255 Ga0466958_0034228
256 Ga0466958_0089259
257 Ga0466967_0000619
258 Ga0466967_0059357
259 Ga0495592_0002483
260 Ga0495590_0035791
261 Ga0495629_0018246
262 Ga0495638_0092801
263 Ga0495651_0003430
264 Ga0495605_0005955
265 Ga0495662_0000269
266 Ga0495664_0010838
267 Ga0495594_0018588
268 Ga0495606_0017990
269 Ga0495610_0012672
270 Ga0495616_0001838
271 Ga0495620_0016263
272 Ga0495628_0045678
273 Ga0495630_0003162
274 Ga0495631_0062423
275 Ga0495643_0058214
276 Ga0495666_0025548
277 Ga0495652_0020898
278 Ga0495640_0013810
279 Ga0495640_0085567
280 Ga0495587_0002745
281 Ga0495645_0067307
282 Ga0495667_0022640
283 Ga0495668_0009851
284 Ga0495634_0004250
285 Ga0495625_0043755
286 Ga0495635_0006861
287 Ga0495588_0003867
288 Ga0495599_0006003
289 Ga0495623_0002580
290 Ga0495646_0000765
291 Ga0495646_0004089
292 Ga0495671_0012040
293 Ga0495589_0001676
294 Ga0495589_0015143
295 Ga0495589_0057111
296 Ga0495600_0002374
297 Ga0495600_0029488
298 Ga0495604_0004530
299 Ga0495674_0013220
300 Ga0495676_0011089
301 Ga0495676_0035173
302 Ga0495687_016099
303 Ga0495675_0002441
304 Ga0495685_004732
305 Ga0495685_004884
306 Ga0495684_0004401
307 Ga0495686_0081062
308 Ga0495602_0005444
309 Ga0495626_0012780
310 Ga0496105_0098450
311 Ga0496108_0069150
312 Ga0496109_0040748
313 Ga0501032_0114239
314 Ga0501034_0017540
315 Ga0501036_0003066
316 Ga0501037_0066598
317 Ga0501038_0045709
318 Ga0501039_0077085
319 Ga0501042_0011558
320 Ga0501043_0001197
321 Ga0501047_0001445
322 Ga0501074_0007866
323 Ga0501044_0014865
324 nmdc:mga05p37_672_c1
325 nmdc:mga09592_2964_c1
326 nmdc:mga0qj67_11814_c1
327 nmdc:mga0qj67_294_c1
328 nmdc:mga06r32_285_c2
329 nmdc:mga06r32_356898_c1
330 Ga0466962_0000253
331 Ga0466962_0007523
332 8048411545
333 2547412729
334 2558907116
335 2585309361
336 2643904339
337 2644264661
338 2644402692
339 2644447220
340 2644631218
341 2784591409
342 2785339729
343 2786673538
344 2808845122
345 2809235011
346 2812354498
347 2812477304
348 2852636116
349 2862182057
350 2862284054
351 2862388719
352 2863410279
353 2867437909
354 2895430750
355 2912716887
356 2935391092
357 2946047316
358 2946071205
359 2946078994
360 2947225548
361 2954010533
362 2954383147
363 2954679844
364 2954684309
365 2954693859
366 2954708970
367 2954723455
368 2954738375
369 2954742359
370 2954757236
371 2954761329
372 2990067032
373 2995469377
374 2997601255
375 3006493206
376 8008564275
377 8023630332
378 8025484983
379 8054165901
380 8055068626
381 8056832701
382 8057572501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

7

46

0.96

PF01266

DAO

FAD dependent oxidoreductase

4

358

0.86

PF12831

FAD_oxidored

FAD dependent oxidoreductase

4

261

0.75

PF00890

FAD_binding_2

FAD binding domain

4

223

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y56-assembly1.cif.gz_B crystal structure of l-proline dehydrogenase from p.horikoshii 0.9407 2 369
3if9-assembly2.cif.gz_D-3 crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate 0.917 2 365
3if9-assembly1.cif.gz_A-2 crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate 0.9147 2 365
1ryi-assembly1.cif.gz_A structure of glycine oxidase with bound inhibitor glycolate 0.9124 2 365
3if9-assembly2.cif.gz_C-3 crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate 0.9115 2 365
ID Description Score Start End Superfamily
af_Q9LV69_44_386_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9276 1 296 3.50.50.60
4yshB02 Alpha Beta;2-Layer Sandwich;D-Amino Acid Oxidase; Chain A, domain 2;D-Amino Acid Oxidase, subunit A, domain 2 0.9222 74 305 3.30.9.10
af_Q69IN1_65_458_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9219 2 341 3.50.50.60
1y56B02 Alpha Beta;2-Layer Sandwich;D-Amino Acid Oxidase; Chain A, domain 2;D-Amino Acid Oxidase, subunit A, domain 2 0.913 74 304 3.30.9.10
4yshB02 Alpha Beta;2-Layer Sandwich;D-Amino Acid Oxidase; Chain A, domain 2;D-Amino Acid Oxidase, subunit A, domain 2 0.8862 74 305 3.30.9.10
ID Description Score Start End GO Terms
AF-A0A100Y7X8-F1-model_v4 FAD-dependent oxidoreductase 0.99 2 366 GO:0005737
AF-A0A1Y2N6B1-F1-model_v4 deleted 0.9842 1 369
AF-A0A2N3UI10-F1-model_v4 deleted 0.9815 2 366
AF-A0A2V8P1E1-F1-model_v4 FAD-dependent oxidoreductase 0.9808 67 366 GO:0005737
AF-A0A1Y2N6B1-F1-model_v4 deleted 0.979 1 369

Map