F294783

General Info

Members Datasets Scaffolds Average Seq Length
191 142 176 788

Family's Representative Sequence

Representative Sequence 3300053093|Ga0500651_0000297|Ga0500651_0000297_25282_27876
Length 846
Sequence LPSRSALPVFATTGLRLAALILPDSPQHARKWRSTDFRRMAKPRSTVMLRNFRPPENLPMPRFALAALIALFCLPSAPAHAITLEQSMADPDWIGPAVETPYWSADGKTIYYKLKRNGSTIRDLHRIDPNGGNDVVVDPAAMAKADGSGIVYDRTRQRAAFARNGDIFIRDIATGRLTQVTRTPQQETAPQFSADGRALQYRSDNDWFVHDIASGVAGPAAIVKTEKDPEAKKPDDLGELQLRLFSTLRTIKADRDTKKENDTNYQKGDPTRTPVPFFLGDDVKIESSALSPDGRHLLIVTSPKGYDEGRVAKLQRYVTESGYEESEDERVRVGRNLPPPNTLWLLDLAGHTQGKIGITDLPGIKDDPLKKIRDENLAAKPASDTETPADRALTVQGIEWTRDGSQVAVQLRANDNKDRWIATVDFGGNKLINQHRLTDPAWINWNFNEFGWTDDNRTLWYLSEESGYSHLYTKLPGGKAKALTAGTFEVSDPALSPDGAWFYLRTNAEAPYSYDVYRVATNGGALNRLTHVKGMDSFALSPDGRQLAVLQSSPYVPSQLAVHPTEGGPAHTLTDTRTTEFKALSWPELEIVGVPSTHTKQPIWSKLYKPADFDASKKYPAVLFVHGAGYLQNTELGYPNYFREQMFHNLLTSQGYIVLDMDYRASAGYGRDWRTAIYRQMGHPELEDLIDGVSWLAANHAVDSKRVGIYGGSYGGFMSLMAMFRAPDMFAAGAALRPVTDWTSYNHGYTSNILNTPQDDAIAYARSSPIEFADGLKGGLLIAHGMIDDNVLFQDSVRLYQRLIELRKDDFELAGYPLERHGFVHSDSWYDEYKRIYKLFEKHLKP

Samples

Sample ID Description Type Environment
1 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
2 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
3 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
4 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
5 2919513703 Luteimonas sp. 3794 Isolate Unclassified
6 2919675420 Luteimonas terrae 4099 Isolate Unclassified
7 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
8 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
9 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
10 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
11 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
12 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
13 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
14 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
15 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
96 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
139 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
140 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
141 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.15
Metatranscriptomes 0
Isolates 7.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 18.85
Nodule 0
Rhizoplane 2.09
Rhizosphere 63.87
Stem 0
Stem Tuber 0
Unclassified 14.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1000003 3300003771 Bacteria 413092
2 Ga0055526_1001392 3300003771 Bacteria 17174
3 Ga0055537_1000287 3300003773 Bacteria 35894
4 Ga0055537_1000362 3300003773 Bacteria 30880
5 Ga0055524_1000002 3300003775 Bacteria 459550
6 Ga0055534_1000050 3300003784 Bacteria 92561
7 Ga0055534_1000637 3300003784 Bacteria 17887
8 Ga0055528_1000001 3300003790 Bacteria 402384
9 Ga0055528_1000406 3300003790 Bacteria 34907
10 Ga0055543_1007665 3300004625 Bacteria 2469
11 Ga0065165_1000035 3300005262 Bacteria 214086
12 Ga0065704_10079041 3300005289 Bacteria 4269
13 Ga0070661_100002051 3300005344 Bacteria 13889
14 Ga0070669_100000007 3300005353 Bacteria 233709
15 Ga0070667_100000235 3300005367 Bacteria 63272
16 Ga0070709_10000025 3300005434 Bacteria 129264
17 Ga0070711_100033815 3300005439 Bacteria 3406
18 Ga0070663_100000261 3300005455 Bacteria 26441
19 Ga0070685_10000745 3300005466 Bacteria 17722
20 Ga0068853_100059907 3300005539 Bacteria 3289
21 Ga0070665_100000280 3300005548 Bacteria 83526
22 Ga0070665_100001350 3300005548 Bacteria 29089
23 Ga0070665_100002183 3300005548 Bacteria 21810
24 Ga0068855_100041539 3300005563 Bacteria 5450
25 Ga0068855_100070000 3300005563 Bacteria 4082
26 Ga0068857_100010770 3300005577 Bacteria 7959
27 Ga0068856_100042217 3300005614 Bacteria 4486
28 Ga0068852_100017375 3300005616 Bacteria 5643
29 Ga0068859_100000400 3300005617 Bacteria 43086
30 Ga0068862_100000530 3300005844 Bacteria 40027
31 Ga0081540_1004438 3300005983 Bacteria 10699
32 Ga0075364_10000696 3300006051 Bacteria 17579
33 Ga0097621_100053378 3300006237 Bacteria 3295
34 Ga0068871_100007883 3300006358 Bacteria 7636
35 Ga0075428_100029794 3300006844 Bacteria 6037
36 Ga0097620_100000400 3300006931 Bacteria 43086
37 Ga0099795_10003363 3300007788 Bacteria 3947
38 Ga0105244_10015693 3300009036 Bacteria 4336
39 Ga0105240_10002634 3300009093 Bacteria 28597
40 Ga0105240_10088674 3300009093 Bacteria 3785
41 Ga0111539_10074945 3300009094 Bacteria 3987
42 Ga0105248_10000167 3300009177 Bacteria 76591
43 Ga0105237_10024062 3300009545 Bacteria 6231
44 Ga0105238_10001780 3300009551 Bacteria 21560
45 Ga0105249_10000271 3300009553 Bacteria 54577
46 Ga0105249_10052838 3300009553 Bacteria 3712
47 Ga0105239_10003787 3300010375 Bacteria 18410
48 Ga0105239_10004853 3300010375 Bacteria 15912
49 Ga0105239_10008744 3300010375 Bacteria 11467
50 Ga0157371_10000158 3300013102 Bacteria 99529
51 Ga0157369_10061813 3300013105 Bacteria 4037
52 Ga0157378_10011368 3300013297 Bacteria 7792
53 Ga0157372_10001239 3300013307 Bacteria 27601
54 Ga0157372_10002917 3300013307 Bacteria 18491
55 Ga0163163_10000779 3300014325 Bacteria 27070
56 Ga0163163_10096881 3300014325 Bacteria 2971
57 Ga0182008_10000360 3300014497 Bacteria 35424
58 Ga0157376_10001576 3300014969 Bacteria 15074
59 Ga0182007_10000019 3300015262 Bacteria 194770
60 Ga0182005_1000088 3300015265 Bacteria 69427
61 Ga0209233_1001016 3300025261 Bacteria 11970
62 Ga0209565_1000002 3300025263 Bacteria 1423083
63 Ga0209565_1000113 3300025263 Bacteria 116343
64 Ga0209673_1000002 3300025273 Bacteria 1423083
65 Ga0209673_1000581 3300025273 Bacteria 57816
66 Ga0209675_1000002 3300025291 Bacteria 1423083
67 Ga0209675_1000007 3300025291 Bacteria 683430
68 Ga0209676_1000018 3300025292 Bacteria 631385
69 Ga0209676_1001924 3300025292 Bacteria 16781
70 Ga0209564_1000004 3300025295 Bacteria 1424639
71 Ga0209564_1000770 3300025295 Bacteria 44617
72 Ga0209050_1000109 3300025298 Bacteria 219706
73 Ga0209050_1000448 3300025298 Bacteria 74673
74 Ga0209256_1000004 3300025299 Bacteria 1424643
75 Ga0209051_1000449 3300025303 Bacteria 54625
76 Ga0209257_1000035 3300025304 Bacteria 631463
77 Ga0209257_1000474 3300025304 Bacteria 73194
78 Ga0209257_1001532 3300025304 Bacteria 26952
79 Ga0207655_1019773 3300025728 Bacteria 3499
80 Ga0207647_10001062 3300025904 Bacteria 21133
81 Ga0207647_10001826 3300025904 Bacteria 16328
82 Ga0207699_10000036 3300025906 Bacteria 129236
83 Ga0207707_10012546 3300025912 Bacteria 7366
84 Ga0207695_10000014 3300025913 Bacteria 812599
85 Ga0207695_10015109 3300025913 Bacteria 9109
86 Ga0207671_10006225 3300025914 Bacteria 10701
87 Ga0207671_10007565 3300025914 Bacteria 9407
88 Ga0207663_10021671 3300025916 Bacteria 3662
89 Ga0207649_10002034 3300025920 Bacteria 11509
90 Ga0207681_10000017 3300025923 Bacteria 294161
91 Ga0207694_10000946 3300025924 Bacteria 25601
92 Ga0207694_10018367 3300025924 Bacteria 5286
93 Ga0207706_10024233 3300025933 Bacteria 5440
94 Ga0207691_10057209 3300025940 Bacteria 3550
95 Ga0207691_10078927 3300025940 Bacteria 2963
96 Ga0207711_10002426 3300025941 Bacteria 16640
97 Ga0207712_10000301 3300025961 Bacteria 46175
98 Ga0207712_10002499 3300025961 Bacteria 11830
99 Ga0207658_10000665 3300025986 Bacteria 30020
100 Ga0207678_10000958 3300026067 Bacteria 26386
101 Ga0207678_10012590 3300026067 Bacteria 7432
102 Ga0207702_10011178 3300026078 Bacteria 7487
103 Ga0207674_10008694 3300026116 Bacteria 11690
104 Ga0207698_10013529 3300026142 Bacteria 5387
105 Ga0268266_10000008 3300028379 Bacteria 1161875
106 Ga0268266_10000017 3300028379 Bacteria 607272
107 Ga0268266_10001127 3300028379 Bacteria 33304
108 Ga0268266_10005416 3300028379 Bacteria 11905
109 Ga0268265_10000150 3300028380 Bacteria 86326
110 Ga0268265_10004238 3300028380 Bacteria 10010
111 Ga0307413_10037676 3300031824 Bacteria 2795
112 Ga0451793_1586308 3300041452 Bacteria 4841
113 Ga0451843_0110991 3300041509 Bacteria 3607
114 Ga0451577_0048737 3300042876 Bacteria 3783
115 Ga0453684_0000330 3300044712 Bacteria 198124
116 Ga0495638_0003743 3300046460 Bacteria 11835
117 Ga0495663_0005445 3300046525 Bacteria 3530
118 Ga0495672_0000069 3300047320 Bacteria 189627
119 Ga0495686_0004347 3300047472 Bacteria 11705
120 Ga0496105_0011931 3300048908 Bacteria 6880
121 Ga0496114_0004901 3300048917 Bacteria 10426
122 Ga0496115_0000002 3300048918 Bacteria 365286
123 Ga0496116_0012417 3300048919 Bacteria 6960
124 Ga0496117_0001903 3300048920 Bacteria 27999
125 Ga0496117_0019229 3300048920 Bacteria 5618
126 Ga0496118_0000274 3300048921 Bacteria 90649
127 Ga0496119_0000787 3300048922 Bacteria 42365
128 Ga0496120_0000776 3300048923 Bacteria 46146
129 Ga0496121_0019137 3300048924 Bacteria 6864
130 Ga0496122_0000079 3300048925 Bacteria 212416
131 Ga0496122_0000136 3300048925 Bacteria 170671
132 Ga0496123_0000073 3300048926 Bacteria 198307
133 Ga0496123_0005874 3300048926 Bacteria 12151
134 Ga0496123_0009582 3300048926 Bacteria 8698
135 Ga0496124_0000486 3300048927 Bacteria 68189
136 Ga0496124_0002068 3300048927 Bacteria 27193
137 Ga0496125_0000486 3300048928 Bacteria 69727
138 Ga0496125_0004219 3300048928 Bacteria 16745
139 Ga0496126_0000052 3300048929 Bacteria 312383
140 Ga0496126_0001695 3300048929 Bacteria 32750
141 Ga0496126_0039172 3300048929 Bacteria 4401
142 Ga0501031_0004623 3300049568 Bacteria 8931
143 Ga0501031_0022958 3300049568 Bacteria 4069
144 Ga0501032_0000758 3300049569 Bacteria 26217
145 Ga0501033_0000455 3300049570 Bacteria 38949
146 Ga0501033_0021358 3300049570 Bacteria 4883
147 Ga0501034_0016596 3300049571 Bacteria 7550
148 Ga0501036_0007257 3300049572 Bacteria 9025
149 Ga0501037_0011958 3300049573 Bacteria 6394
150 Ga0501038_0001474 3300049574 Bacteria 21647
151 Ga0501039_0018296 3300049575 Bacteria 5377
152 Ga0501043_0051320 3300049579 Bacteria 3240
153 Ga0501043_0069912 3300049579 Bacteria 2757
154 Ga0501046_0011341 3300049580 Bacteria 7627
155 Ga0501046_0056362 3300049580 Bacteria 3085
156 Ga0501047_0003431 3300049581 Bacteria 14984
157 Ga0501047_0073769 3300049581 Bacteria 3285
158 Ga0501048_0018701 3300049582 Bacteria 5093
159 Ga0501070_0067099 3300049586 Bacteria 2971
160 Ga0501073_0005816 3300049589 Bacteria 9214
161 Ga0501079_0050812 3300049741 Bacteria 3199
162 Ga0501080_0006055 3300049742 Bacteria 10843
163 Ga0501080_0034615 3300049742 Bacteria 4716
164 Ga0501083_0003777 3300049744 Bacteria 10631
165 Ga0501035_0036942 3300049822 Bacteria 4425
166 Ga0501044_0002246 3300049823 Bacteria 22070
167 Ga0501044_0045807 3300049823 Bacteria 4530
168 Ga0501044_0075878 3300049823 Bacteria 3413
169 nmdc:mga00v17_35217_c1 3300050491 Bacteria 2978
170 nmdc:mga00v17_67_c2 3300050491 Bacteria 34972
171 nmdc:mga0n895_2021_c1 3300050512 Bacteria 15600
172 Ga0500610_0000284 3300053079 Bacteria 15301
173 Ga0500643_000450 3300053087 Bacteria 30395
174 Ga0500651_0000297 3300053093 Bacteria 28799
175 Ga0500568_0002707 3300053139 Bacteria 10279
176 Ga0501082_0000983 3300060353 Bacteria 25153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025940 Ga0207691_10078927 Ga0207691_100789272 705
2 3300042876 Ga0451577_0048737 Ga0451577_0048737_391_2772 709
3 3300005353 Ga0070669_100000007 Ga0070669_10000000724 710
4 3300025923 Ga0207681_10000017 Ga0207681_10000017178 710
5 3300025916 Ga0207663_10021671 Ga0207663_100216712 732
6 3300048908 Ga0496105_0011931 Ga0496105_0011931_1478_3892 732
7 3300048917 Ga0496114_0004901 Ga0496114_0004901_1948_4362 732
8 3300025261 Ga0209233_1001016 Ga0209233_10010169 736
9 3300044712 Ga0453684_0000330 Ga0453684_0000330_58382_60736 736
10 3300005434 Ga0070709_10000025 Ga0070709_1000002531 739
11 3300005548 Ga0070665_100000280 Ga0070665_10000028044 739
12 3300006051 Ga0075364_10000696 Ga0075364_1000069612 739
13 3300025906 Ga0207699_10000036 Ga0207699_1000003631 739
14 3300028379 Ga0268266_10001127 Ga0268266_1000112727 739
15 3300050491 nmdc:mga00v17_67_c2 nmdc:mga00v17_67_c2_3438_5792 739
16 3300049568 Ga0501031_0022958 Ga0501031_0022958_1350_3779 740
17 3300049580 Ga0501046_0056362 Ga0501046_0056362_288_2717 740
18 3300006844 Ga0075428_100029794 Ga0075428_1000297942 742
19 3300025914 Ga0207671_10006225 Ga0207671_100062253 742
20 3300005289 Ga0065704_10079041 Ga0065704_100790414 743
21 3300005455 Ga0070663_100000261 Ga0070663_10000026114 744
22 3300005616 Ga0068852_100017375 Ga0068852_1000173752 744
23 3300026067 Ga0207678_10000958 Ga0207678_1000095818 744
24 3300048918 Ga0496115_0000002 Ga0496115_0000002_194362_196791 744
25 3300048925 Ga0496122_0000136 Ga0496122_0000136_7551_10028 744
26 3300048926 Ga0496123_0005874 Ga0496123_0005874_2204_4681 744
27 3300048929 Ga0496126_0000052 Ga0496126_0000052_141533_143962 744
28 3300005466 Ga0070685_10000745 Ga0070685_1000074512 745
29 3300007788 Ga0099795_10003363 Ga0099795_100033633 745
30 3300009093 Ga0105240_10002634 Ga0105240_1000263414 745
31 3300009551 Ga0105238_10001780 Ga0105238_1000178012 745
32 3300025913 Ga0207695_10000014 Ga0207695_1000001453 745
33 3300025924 Ga0207694_10000946 Ga0207694_1000094614 745
34 3300026142 Ga0207698_10013529 Ga0207698_100135293 745
35 3300009553 Ga0105249_10000271 Ga0105249_1000027151 747
36 3300025961 Ga0207712_10000301 Ga0207712_100003013 747
37 3300005983 Ga0081540_1004438 Ga0081540_10044389 748
38 3300010375 Ga0105239_10003787 Ga0105239_1000378715 749
39 3300025904 Ga0207647_10001826 Ga0207647_1000182610 750
40 3300005617 Ga0068859_100000400 Ga0068859_10000040031 751
41 3300006931 Ga0097620_100000400 Ga0097620_10000040031 751
42 3300025933 Ga0207706_10024233 Ga0207706_100242333 751
43 3300005563 Ga0068855_100041539 Ga0068855_1000415392 752
44 3300005844 Ga0068862_100000530 Ga0068862_10000053021 752
45 3300006358 Ga0068871_100007883 Ga0068871_1000078833 752
46 3300010375 Ga0105239_10008744 Ga0105239_1000874410 752
47 3300014969 Ga0157376_10001576 Ga0157376_1000157612 752
48 3300028379 Ga0268266_10005416 Ga0268266_100054167 752
49 3300028380 Ga0268265_10004238 Ga0268265_100042385 752
50 3300049741 Ga0501079_0050812 Ga0501079_0050812_413_2842 752
51 3300049742 Ga0501080_0006055 Ga0501080_0006055_7583_10012 752
52 3300049822 Ga0501035_0036942 Ga0501035_0036942_1308_3737 752
53 3300005367 Ga0070667_100000235 Ga0070667_1000002352 753
54 3300009177 Ga0105248_10000167 Ga0105248_1000016711 753
55 3300025940 Ga0207691_10057209 Ga0207691_100572091 753
56 3300025941 Ga0207711_10002426 Ga0207711_1000242610 753
57 3300025986 Ga0207658_10000665 Ga0207658_1000066518 753
58 3300047472 Ga0495686_0004347 Ga0495686_0004347_42_2519 753
59 3300048929 Ga0496126_0039172 Ga0496126_0039172_1813_4290 753
60 3300026116 Ga0207674_10008694 Ga0207674_100086948 755
61 3300050491 nmdc:mga00v17_35217_c1 nmdc:mga00v17_35217_c1_356_2725 756
62 3300053087 Ga0500643_000450 Ga0500643_000450_7508_9985 756
63 3300049579 Ga0501043_0069912 Ga0501043_0069912_141_2702 757
64 3300049823 Ga0501044_0075878 Ga0501044_0075878_20_2443 757
65 3300005344 Ga0070661_100002051 Ga0070661_10000205110 758
66 3300005563 Ga0068855_100070000 Ga0068855_1000700002 758
67 3300009093 Ga0105240_10088674 Ga0105240_100886743 758
68 3300009094 Ga0111539_10074945 Ga0111539_100749452 758
69 3300013105 Ga0157369_10061813 Ga0157369_100618133 758
70 3300013307 Ga0157372_10002917 Ga0157372_100029175 758
71 3300025913 Ga0207695_10015109 Ga0207695_100151092 758
72 3300025914 Ga0207671_10007565 Ga0207671_100075657 758
73 3300025920 Ga0207649_10002034 Ga0207649_100020349 758
74 3300025924 Ga0207694_10018367 Ga0207694_100183673 758
75 3300031824 Ga0307413_10037676 Ga0307413_100376762 759
76 3300004625 Ga0055543_1007665 Ga0055543_10076651 760
77 3300005262 Ga0065165_1000035 Ga0065165_1000035178 760
78 3300025912 Ga0207707_10012546 Ga0207707_100125462 760
79 3300050512 nmdc:mga0n895_2021_c1 nmdc:mga0n895_2021_c1_7949_10555 760
80 3300010375 Ga0105239_10004853 Ga0105239_100048538 761
81 3300025292 Ga0209676_1000018 Ga0209676_1000018471 763
82 3300025292 Ga0209676_1001924 Ga0209676_10019246 763
83 3300025298 Ga0209050_1000448 Ga0209050_100044853 763
84 3300025303 Ga0209051_1000449 Ga0209051_100044945 763
85 3300025304 Ga0209257_1000035 Ga0209257_1000035471 763
86 3300025304 Ga0209257_1001532 Ga0209257_100153212 763
87 3300041452 Ga0451793_1586308 Ga0451793_1586308_827_3265 763
88 3300049744 Ga0501083_0003777 Ga0501083_0003777_1457_3934 763
89 3300060353 Ga0501082_0000983 Ga0501082_0000983_12933_15344 763
90 3300014325 Ga0163163_10096881 Ga0163163_100968812 764
91 3300025304 Ga0209257_1000474 Ga0209257_100047463 764
92 3300025961 Ga0207712_10002499 Ga0207712_100024993 764
93 3300048925 Ga0496122_0000079 Ga0496122_0000079_186182_188554 764
94 3300048926 Ga0496123_0000073 Ga0496123_0000073_20922_23294 764
95 3300005539 Ga0068853_100059907 Ga0068853_1000599072 765
96 3300026067 Ga0207678_10012590 Ga0207678_100125902 765
97 3300028380 Ga0268265_10000150 Ga0268265_1000015069 765
98 3300049568 Ga0501031_0004623 Ga0501031_0004623_4343_6793 765
99 3300049569 Ga0501032_0000758 Ga0501032_0000758_7278_9728 765
100 3300049570 Ga0501033_0021358 Ga0501033_0021358_473_2923 765
101 3300049571 Ga0501034_0016596 Ga0501034_0016596_4685_7135 765
102 3300049572 Ga0501036_0007257 Ga0501036_0007257_6058_8508 765
103 3300049573 Ga0501037_0011958 Ga0501037_0011958_3814_6264 765
104 3300049574 Ga0501038_0001474 Ga0501038_0001474_16327_18777 765
105 3300049575 Ga0501039_0018296 Ga0501039_0018296_2287_4737 765
106 3300049579 Ga0501043_0051320 Ga0501043_0051320_259_2709 765
107 3300049580 Ga0501046_0011341 Ga0501046_0011341_1525_3975 765
108 3300049581 Ga0501047_0003431 Ga0501047_0003431_9958_12408 765
109 3300049582 Ga0501048_0018701 Ga0501048_0018701_1132_3582 765
110 3300049589 Ga0501073_0005816 Ga0501073_0005816_2620_5070 765
111 3300049742 Ga0501080_0034615 Ga0501080_0034615_223_2673 765
112 3300049823 Ga0501044_0002246 Ga0501044_0002246_12145_14595 765
113 iso_pu_bacteria 2987605356 2987606887 765
114 3300009553 Ga0105249_10052838 Ga0105249_100528382 766
115 iso_pu_bacteria 2576861471 2578456439 766
116 iso_pu_bacteria 2842757796 2842761267 766
117 iso_pu_bacteria 2852649853 2852651684 766
118 iso_pu_bacteria 2857442823 2857444577 766
119 iso_pu_bacteria 2939589442 2939590321 766
120 iso_pu_bacteria 2939622612 2939626600 766
121 iso_pu_bacteria 2941475908 2941479535 766
122 iso_pu_bacteria 2974307012 2974307097 766
123 iso_pu_bacteria 2977247770 2977247842 766
124 iso_pu_bacteria 2984514374 2984517702 766
125 3300009545 Ga0105237_10024062 Ga0105237_100240622 767
126 3300013297 Ga0157378_10011368 Ga0157378_100113684 767
127 3300053139 Ga0500568_0002707 Ga0500568_0002707_2572_5163 767
128 3300005548 Ga0070665_100001350 Ga0070665_10000135027 768
129 3300005548 Ga0070665_100002183 Ga0070665_10000218315 768
130 3300005577 Ga0068857_100010770 Ga0068857_1000107703 768
131 3300014325 Ga0163163_10000779 Ga0163163_100007793 768
132 3300025904 Ga0207647_10001062 Ga0207647_100010626 768
133 3300028379 Ga0268266_10000008 Ga0268266_10000008762 768
134 3300028379 Ga0268266_10000017 Ga0268266_10000017441 768
135 3300046525 Ga0495663_0005445 Ga0495663_0005445_228_2594 769
136 3300009036 Ga0105244_10015693 Ga0105244_100156932 770
137 3300013102 Ga0157371_10000158 Ga0157371_1000015819 770
138 3300014497 Ga0182008_10000360 Ga0182008_1000036024 770
139 3300015262 Ga0182007_10000019 Ga0182007_1000001938 770
140 3300015265 Ga0182005_1000088 Ga0182005_100008831 770
141 3300046460 Ga0495638_0003743 Ga0495638_0003743_5556_7922 770
142 3300048919 Ga0496116_0012417 Ga0496116_0012417_4150_6516 770
143 3300048920 Ga0496117_0001903 Ga0496117_0001903_7219_9585 770
144 3300048922 Ga0496119_0000787 Ga0496119_0000787_1070_3436 770
145 3300048923 Ga0496120_0000776 Ga0496120_0000776_42532_44898 770
146 3300048924 Ga0496121_0019137 Ga0496121_0019137_2919_5285 770
147 3300048926 Ga0496123_0009582 Ga0496123_0009582_5938_8304 770
148 3300048927 Ga0496124_0000486 Ga0496124_0000486_19884_22250 770
149 3300048927 Ga0496124_0002068 Ga0496124_0002068_19213_21579 770
150 3300048928 Ga0496125_0000486 Ga0496125_0000486_33076_35442 770
151 3300048928 Ga0496125_0004219 Ga0496125_0004219_7571_9937 770
152 3300048929 Ga0496126_0001695 Ga0496126_0001695_5709_8075 770
153 iso_pu_bacteria 2919513703 2919514385 770
154 iso_pu_bacteria 2919675420 2919677669 770
155 3300005439 Ga0070711_100033815 Ga0070711_1000338151 771
156 3300005614 Ga0068856_100042217 Ga0068856_1000422173 771
157 3300006237 Ga0097621_100053378 Ga0097621_1000533782 771
158 3300013307 Ga0157372_10001239 Ga0157372_1000123910 771
159 3300026078 Ga0207702_10011178 Ga0207702_100111784 771
160 3300041509 Ga0451843_0110991 Ga0451843_0110991_935_3394 771
161 3300048920 Ga0496117_0019229 Ga0496117_0019229_3092_5566 771
162 3300048921 Ga0496118_0000274 Ga0496118_0000274_84673_87147 771
163 3300049570 Ga0501033_0000455 Ga0501033_0000455_36453_38882 771
164 3300049581 Ga0501047_0073769 Ga0501047_0073769_68_2497 771
165 3300049586 Ga0501070_0067099 Ga0501070_0067099_258_2750 771
166 3300049823 Ga0501044_0045807 Ga0501044_0045807_1972_4398 771
167 3300053079 Ga0500610_0000284 Ga0500610_0000284_339_2783 771
168 3300053093 Ga0500651_0000297 Ga0500651_0000297_25282_27876 771
169 3300003771 Ga0055526_1001392 Ga0055526_10013929 772
170 3300003773 Ga0055537_1000362 Ga0055537_100036213 772
171 3300003784 Ga0055534_1000637 Ga0055534_10006373 772
172 3300003790 Ga0055528_1000406 Ga0055528_100040617 772
173 3300025263 Ga0209565_1000113 Ga0209565_100011327 772
174 3300025273 Ga0209673_1000581 Ga0209673_100058147 772
175 3300025291 Ga0209675_1000007 Ga0209675_100000775 772
176 3300025295 Ga0209564_1000770 Ga0209564_100077012 772
177 3300025298 Ga0209050_1000109 Ga0209050_1000109179 772
178 3300025728 Ga0207655_1019773 Ga0207655_10197733 774
179 3300047320 Ga0495672_0000069 Ga0495672_0000069_165714_168194 774
180 iso_pu_bacteria 2941489479 2941493127 775
181 iso_pu_bacteria 2995948881 2995949214 775
182 3300003771 Ga0055526_1000003 Ga0055526_1000003307 779
183 3300003773 Ga0055537_1000287 Ga0055537_10002879 779
184 3300003775 Ga0055524_1000002 Ga0055524_100000259 779
185 3300003784 Ga0055534_1000050 Ga0055534_100005023 779
186 3300003790 Ga0055528_1000001 Ga0055528_100000159 779
187 3300025263 Ga0209565_1000002 Ga0209565_1000002519 779
188 3300025273 Ga0209673_1000002 Ga0209673_1000002519 779
189 3300025291 Ga0209675_1000002 Ga0209675_1000002519 779
190 3300025295 Ga0209564_1000004 Ga0209564_1000004520 779
191 3300025299 Ga0209256_1000004 Ga0209256_1000004520 779

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00326

Peptidase_S9

Prolyl oligopeptidase family

641

846

0.96

PF00930

DPPIV_N

Dipeptidyl peptidase IV (DPP IV) N-terminal region

374

558

0.87

PF01738

DLH

Dienelactone hydrolase family

613

840

0.84

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

601

752

0.82

PF07676

PD40

WD40-like Beta Propeller Repeat

96

120

0.81

PF20434

BD-FAE

BD-FAE

606

803

0.78

PF00756

Esterase

Putative esterase

596

770

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.819 538 779
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.811 538 779
5yp1-assembly1.cif.gz_A crystal structure of dipeptidyl peptidase iv (dpp iv) from pseudoxanthomonas mexicana wo24 0.801 28 779
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.799 522 775
5yp1-assembly1.cif.gz_A crystal structure of dipeptidyl peptidase iv (dpp iv) from pseudoxanthomonas mexicana wo24 0.7978 28 779
ID Description Score Start End Superfamily
2ecfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9318 519 779 3.40.50.1820
af_M0R781_602_862_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9264 519 777 3.40.50.1820
5oljA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9252 519 777 3.40.50.1820
5oljA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9217 519 777 3.40.50.1820
2ecfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9216 519 779 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4Q5TAN6-F1-model_v4 S9 family peptidase 0.9982 642 779 GO:0006508
GO:0008236
GO:0008239
AF-A0A4Q5TAN6-F1-model_v4 S9 family peptidase 0.991 642 779 GO:0006508
GO:0008236
GO:0008239
AF-A0A0S7WFV5-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.9845 604 777 GO:0006508
GO:0008236
GO:0008239
AF-A0A5C7SM28-F1-model_v4 S9 family peptidase 0.9795 677 779 GO:0006508
GO:0008236
GO:0008239
AF-A0A0S7WFV5-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.9734 604 777 GO:0006508
GO:0008236
GO:0008239

Feature Viewer

pLDDT pTM Quality
89.85 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map