F294738

General Info

Members Datasets Scaffolds Average Seq Length
191 119 176 144

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0003704|Ga0501083_0003704_108_590
Length 160
Sequence MRERRSHQKNSTHPTMAHVSTYLNFPRNTEAAFDFYRSVFKTDYARPIVRFKDGPPCPGQPPLPPGDANLVMHVALPIIGGHMLMGTDAPDSMGFSCKAGNNVFINLEPDTRAETDRLFAALSAGGKVEMPLQVMFWGDYFGTLTDKFGIQWMFNCASKT

Samples

Sample ID Description Type Environment
1 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
2 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
3 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
4 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
5 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
6 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
7 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
8 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
9 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
10 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
11 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
12 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
13 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
14 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
15 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
56 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
57 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
78 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
79 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
80 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
81 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
82 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
83 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
84 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
103 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
111 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
112 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
119 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.62
Metatranscriptomes 0.52
Isolates 7.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 3.14
Rhizosphere 84.82
Stem 0
Stem Tuber 0
Unclassified 10.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10048066 3300003316 Bacteria 2942
2 rootH2_10020112 3300003320 Bacteria 13144
3 rootL2_10135615 3300003322 Bacteria 2428
4 Ga0070666_10169219 3300005335 Bacteria 1530
5 Ga0070687_100161916 3300005343 Bacteria 1323
6 Ga0070673_100535649 3300005364 Bacteria 1062
7 Ga0070667_100489699 3300005367 Bacteria 1126
8 Ga0070667_100961306 3300005367 Bacteria 796
9 Ga0070708_100141695 3300005445 Bacteria 2230
10 Ga0070708_100235831 3300005445 Bacteria 1717
11 Ga0070678_101024326 3300005456 Bacteria 760
12 Ga0068867_100201180 3300005459 Bacteria 1595
13 Ga0070707_100103823 3300005468 Bacteria 2754
14 Ga0070699_100468709 3300005518 Unclassified 1142
15 Ga0070699_101737266 3300005518 Bacteria 571
16 Ga0070684_100245197 3300005535 Unclassified 1637
17 Ga0070697_100050385 3300005536 Bacteria 3379
18 Ga0068856_100019965 3300005614 Bacteria 6505
19 Ga0068858_100289442 3300005842 Bacteria 1561
20 Ga0068858_101590191 3300005842 Bacteria 645
21 Ga0068860_101851735 3300005843 Bacteria 625
22 Ga0068860_102316950 3300005843 Unclassified 557
23 Ga0075430_100032771 3300006846 Unclassified 4409
24 Ga0075433_10956758 3300006852 Bacteria 746
25 Ga0111539_10007510 3300009094 Bacteria 13954
26 Ga0111539_10252790 3300009094 Bacteria 2052
27 Ga0105242_10289212 3300009176 Bacteria 1491
28 Ga0105248_11084150 3300009177 Bacteria 905
29 Ga0105249_10855144 3300009553 Bacteria 975
30 Ga0105246_10373225 3300011119 Bacteria 1176
31 Ga0105246_11378460 3300011119 Unclassified 657
32 Ga0157369_10086834 3300013105 Bacteria 3341
33 Ga0157369_10109554 3300013105 Unclassified 2936
34 Ga0157369_10297435 3300013105 Bacteria 1680
35 Ga0163162_10047701 3300013306 Bacteria 4292
36 Ga0163162_10420575 3300013306 Bacteria 1469
37 Ga0157375_10205227 3300013308 Bacteria 2127
38 Ga0157380_11534153 3300014326 Bacteria 720
39 Ga0163161_10122102 3300017792 Bacteria 1958
40 Ga0224712_10360167 3300022467 Bacteria 688
41 Ga0207680_10075767 3300025903 Bacteria 2099
42 Ga0207662_10439633 3300025918 Bacteria 890
43 Ga0207661_10001368 3300025944 Bacteria 16358
44 Ga0207651_11087006 3300025960 Bacteria 716
45 Ga0207639_10754970 3300026041 Unclassified 905
46 Ga0207641_11334940 3300026088 Bacteria 718
47 Ga0207648_10083192 3300026089 Bacteria 2791
48 Ga0207428_10014351 3300027907 Bacteria 6889
49 Ga0268264_11787378 3300028381 Bacteria 625
50 Ga0268264_12002917 3300028381 Unclassified 588
51 Ga0265334_10155481 3300028573 Unclassified 805
52 Ga0307515_10000001 3300028794 Bacteria 4259510
53 Ga0316180_1073846 3300030736 Bacteria 963
54 Ga0307408_100000505 3300031548 Bacteria 33886
55 Ga0307408_100000523 3300031548 Bacteria 33139
56 Ga0307408_100024343 3300031548 Bacteria 4133
57 Ga0307408_100147880 3300031548 Bacteria 1851
58 Ga0307408_100236211 3300031548 Bacteria 1500
59 Ga0307408_100275089 3300031548 Bacteria 1400
60 Ga0307408_100744762 3300031548 Bacteria 884
61 Ga0307408_101205548 3300031548 Bacteria 706
62 Ga0307405_10016785 3300031731 Bacteria 4000
63 Ga0307405_10069388 3300031731 Bacteria 2259
64 Ga0307405_10125904 3300031731 Bacteria 1761
65 Ga0307405_10286764 3300031731 Bacteria 1242
66 Ga0307405_10551481 3300031731 Bacteria 933
67 Ga0307413_10234679 3300031824 Bacteria 1349
68 Ga0307413_10524861 3300031824 Bacteria 955
69 Ga0307410_10073165 3300031852 Bacteria 2382
70 Ga0307410_10222385 3300031852 Bacteria 1453
71 Ga0307410_10419169 3300031852 Bacteria 1085
72 Ga0307410_10710207 3300031852 Bacteria 848
73 Ga0307406_10056311 3300031901 Bacteria 2517
74 Ga0307406_10233443 3300031901 Bacteria 1375
75 Ga0307407_10076087 3300031903 Bacteria 2014
76 Ga0307407_10197965 3300031903 Bacteria 1344
77 Ga0307407_10494858 3300031903 Bacteria 895
78 Ga0307407_10645706 3300031903 Bacteria 792
79 Ga0307412_10012455 3300031911 Bacteria 4959
80 Ga0307412_10030125 3300031911 Bacteria 3412
81 Ga0307412_10167291 3300031911 Bacteria 1640
82 Ga0307409_100075539 3300031995 Bacteria 2698
83 Ga0307409_100080222 3300031995 Bacteria 2632
84 Ga0307409_100152240 3300031995 Bacteria 2010
85 Ga0307409_100273014 3300031995 Bacteria 1558
86 Ga0307416_100076375 3300032002 Bacteria 2807
87 Ga0307416_100174860 3300032002 Bacteria 2004
88 Ga0307416_100878794 3300032002 Bacteria 995
89 Ga0307416_101008843 3300032002 Bacteria 935
90 Ga0307414_10033206 3300032004 Bacteria 3408
91 Ga0307414_10252047 3300032004 Bacteria 1468
92 Ga0307411_10010825 3300032005 Bacteria 4885
93 Ga0307411_10057340 3300032005 Unclassified 2572
94 Ga0307415_102038614 3300032126 Bacteria 559
95 Ga0373951_0003167 3300035091 Unclassified 4044
96 Ga0373937_0035578 3300036401 Unclassified 4534
97 Ga0395899_0099138 3300037312 Bacteria 2105
98 Ga0395900_0098255 3300037418 Bacteria 3008
99 Ga0395898_0040734 3300037466 Bacteria 4592
100 Ga0395905_0587065 3300037471 Unclassified 1016
101 Ga0395905_1884888 3300037471 Bacteria 504
102 Ga0395901_0179370 3300038443 Bacteria 2221
103 Ga0439466_0082700 3300041411 Bacteria 1012
104 Ga0451807_0151585 3300041486 Unclassified 792
105 Ga0451807_0815295 3300041486 Unclassified 583
106 Ga0451807_1407617 3300041486 Bacteria 1208
107 Ga0451845_0741344 3300041501 Bacteria 736
108 Ga0439431_0011747 3300041997 Bacteria 2005
109 Ga0439442_000229 3300042002 Bacteria 13772
110 Ga0439457_030904 3300042014 Bacteria 1188
111 Ga0439463_116388 3300042016 Bacteria 690
112 Ga0450911_001800 3300042115 Bacteria 4595
113 Ga0451577_0000002 3300042876 Bacteria 1731375
114 Ga0451577_0004832 3300042876 Bacteria 14070
115 Ga0451577_0021627 3300042876 Bacteria 5884
116 Ga0451577_0101594 3300042876 Bacteria 2569
117 Ga0451577_0218361 3300042876 Bacteria 1723
118 Ga0451577_0359219 3300042876 Bacteria 1321
119 Ga0466972_0011962 3300044658 Bacteria 4360
120 Ga0453683_0000003 3300044673 Bacteria 942572
121 Ga0453683_0140806 3300044673 Bacteria 1522
122 Ga0466965_0005348 3300044683 Bacteria 5781
123 Ga0453684_0000002 3300044712 Bacteria 1731375
124 Ga0453684_0001369 3300044712 Bacteria 70779
125 Ga0453684_0005549 3300044712 Bacteria 24899
126 Ga0453684_0017284 3300044712 Bacteria 11187
127 Ga0453684_0063330 3300044712 Bacteria 4731
128 Ga0453684_0138420 3300044712 Bacteria 2911
129 Ga0453684_0156290 3300044712 Unclassified 2703
130 Ga0453684_0334330 3300044712 Bacteria 1712
131 Ga0453684_0608244 3300044712 Bacteria 1197
132 Ga0453684_0716333 3300044712 Bacteria 1086
133 Ga0453684_0860793 3300044712 Bacteria 973
134 Ga0466971_0193041 3300044719 Bacteria 960
135 Ga0466970_0115860 3300044765 Bacteria 1465
136 Ga0451576_0000004 3300045051 Bacteria 1312238
137 Ga0451576_0043743 3300045051 Bacteria 4724
138 Ga0451576_0141843 3300045051 Bacteria 2505
139 Ga0451576_0165004 3300045051 Bacteria 2311
140 Ga0451576_0477282 3300045051 Bacteria 1310
141 Ga0495650_0116343 3300046471 Bacteria 988
142 Ga0495664_0306230 3300046477 Unclassified 959
143 Ga0495594_0338911 3300046499 Unclassified 856
144 Ga0495586_0292295 3300046535 Bacteria 933
145 Ga0496112_0127537 3300048915 Bacteria 2515
146 Ga0496113_0344326 3300048916 Bacteria 1195
147 Ga0496114_1403114 3300048917 Unclassified 586
148 Ga0496122_0181580 3300048925 Unclassified 1254
149 Ga0496124_0138872 3300048927 Bacteria 1920
150 Ga0496125_0004054 3300048928 Bacteria 17159
151 Ga0496125_0024932 3300048928 Bacteria 5488
152 Ga0496125_0089069 3300048928 Bacteria 2322
153 Ga0496126_0058807 3300048929 Bacteria 3464
154 Ga0496126_0156914 3300048929 Bacteria 1947
155 Ga0501033_0066822 3300049570 Bacteria 2644
156 Ga0501033_0716613 3300049570 Unclassified 680
157 Ga0501034_0876541 3300049571 Unclassified 787
158 Ga0501038_0793962 3300049574 Bacteria 704
159 Ga0501042_0002796 3300049578 Bacteria 10794
160 Ga0501047_0607522 3300049581 Bacteria 915
161 Ga0501070_0217742 3300049586 Unclassified 1566
162 Ga0501198_017290 3300049649 Bacteria 1122
163 Ga0501243_000576 3300049675 Bacteria 4912
164 Ga0501250_084465 3300049680 Bacteria 544
165 Ga0501083_0000073 3300049744 Bacteria 66532
166 Ga0501083_0003704 3300049744 Bacteria 10733
167 Ga0501083_0005532 3300049744 Bacteria 8954
168 Ga0501083_0006257 3300049744 Bacteria 8448
169 Ga0501279_012574 3300049775 Bacteria 1152
170 Ga0501279_075038 3300049775 Bacteria 575
171 Ga0501044_0286163 3300049823 Bacteria 1581
172 nmdc:mga0qj67_240781_c1 3300050509 Bacteria 1468
173 nmdc:mga08y16_4963_c1 3300050511 Bacteria 13905
174 nmdc:mga08y16_93253_c1 3300050511 Bacteria 3137
175 Ga0500593_146466 3300053117 Bacteria 922
176 Ga0500622_0002747 3300053156 Bacteria 12416

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_1884888 Ga0395905_1884888_16_393 118
2 3300049570 Ga0501033_0066822 Ga0501033_0066822_1897_2319 132
3 3300049578 Ga0501042_0002796 Ga0501042_0002796_7395_7850 132
4 3300049581 Ga0501047_0607522 Ga0501047_0607522_47_502 132
5 3300049744 Ga0501083_0000073 Ga0501083_0000073_27748_28203 132
6 3300049744 Ga0501083_0006257 Ga0501083_0006257_5397_5819 132
7 3300049823 Ga0501044_0286163 Ga0501044_0286163_55_507 132
8 iso_pu_bacteria 2690315906 2691513778 132
9 iso_pu_bacteria 2775506735 2775658064 132
10 iso_pu_bacteria 2808606357 2808831056 132
11 iso_pu_bacteria 2808606360 2808852318 132
12 iso_pu_bacteria 2808606370 2808891106 132
13 iso_pu_bacteria 2808606371 2808896365 132
14 iso_pu_bacteria 2811994871 2812321252 132
15 iso_pu_bacteria 2945916053 2945919005 132
16 iso_pu_bacteria 2945920336 2945920592 132
17 iso_pu_bacteria 2945941187 2945943185 132
18 iso_pu_bacteria 2946037020 2946039098 132
19 iso_pu_bacteria 2946059875 2946062861 132
20 iso_pu_bacteria 2953998280 2954000485 132
21 iso_pu_bacteria 2977232053 2977234388 132
22 3300005445 Ga0070708_100235831 Ga0070708_1002358312 135
23 3300005518 Ga0070699_101737266 Ga0070699_1017372661 135
24 3300011119 Ga0105246_10373225 Ga0105246_103732251 135
25 3300013105 Ga0157369_10086834 Ga0157369_100868344 135
26 3300013105 Ga0157369_10297435 Ga0157369_102974352 135
27 3300022467 Ga0224712_10360167 Ga0224712_103601671 135
28 3300031548 Ga0307408_100024343 Ga0307408_1000243434 135
29 3300031548 Ga0307408_100147880 Ga0307408_1001478803 135
30 3300031548 Ga0307408_100236211 Ga0307408_1002362112 135
31 3300031548 Ga0307408_100744762 Ga0307408_1007447622 135
32 3300031548 Ga0307408_101205548 Ga0307408_1012055482 135
33 3300031731 Ga0307405_10016785 Ga0307405_100167852 135
34 3300031731 Ga0307405_10069388 Ga0307405_100693883 135
35 3300031731 Ga0307405_10125904 Ga0307405_101259042 135
36 3300031731 Ga0307405_10286764 Ga0307405_102867642 135
37 3300031824 Ga0307413_10234679 Ga0307413_102346792 135
38 3300031824 Ga0307413_10524861 Ga0307413_105248612 135
39 3300031852 Ga0307410_10073165 Ga0307410_100731653 135
40 3300031852 Ga0307410_10222385 Ga0307410_102223852 135
41 3300031852 Ga0307410_10419169 Ga0307410_104191692 135
42 3300031852 Ga0307410_10710207 Ga0307410_107102072 135
43 3300031901 Ga0307406_10056311 Ga0307406_100563113 135
44 3300031901 Ga0307406_10233443 Ga0307406_102334432 135
45 3300031903 Ga0307407_10076087 Ga0307407_100760873 135
46 3300031903 Ga0307407_10197965 Ga0307407_101979652 135
47 3300031903 Ga0307407_10494858 Ga0307407_104948582 135
48 3300031903 Ga0307407_10645706 Ga0307407_106457062 135
49 3300031911 Ga0307412_10012455 Ga0307412_100124554 135
50 3300031911 Ga0307412_10167291 Ga0307412_101672912 135
51 3300031995 Ga0307409_100075539 Ga0307409_1000755392 135
52 3300031995 Ga0307409_100080222 Ga0307409_1000802223 135
53 3300031995 Ga0307409_100273014 Ga0307409_1002730142 135
54 3300032002 Ga0307416_100076375 Ga0307416_1000763752 135
55 3300032002 Ga0307416_100878794 Ga0307416_1008787941 135
56 3300032002 Ga0307416_101008843 Ga0307416_1010088431 135
57 3300032004 Ga0307414_10033206 Ga0307414_100332063 135
58 3300032004 Ga0307414_10252047 Ga0307414_102520472 135
59 3300032005 Ga0307411_10010825 Ga0307411_100108253 135
60 3300032126 Ga0307415_102038614 Ga0307415_1020386141 135
61 3300037312 Ga0395899_0099138 Ga0395899_0099138_1428_1859 135
62 3300037418 Ga0395900_0098255 Ga0395900_0098255_400_831 135
63 3300037466 Ga0395898_0040734 Ga0395898_0040734_1170_1601 135
64 3300038443 Ga0395901_0179370 Ga0395901_0179370_1180_1611 135
65 3300042002 Ga0439442_000229 Ga0439442_000229_12494_12925 135
66 3300044658 Ga0466972_0011962 Ga0466972_0011962_965_1402 135
67 3300044683 Ga0466965_0005348 Ga0466965_0005348_4994_5431 135
68 3300044719 Ga0466971_0193041 Ga0466971_0193041_430_867 135
69 3300044765 Ga0466970_0115860 Ga0466970_0115860_497_934 135
70 3300046535 Ga0495586_0292295 Ga0495586_0292295_490_921 135
71 3300048915 Ga0496112_0127537 Ga0496112_0127537_874_1305 135
72 3300048916 Ga0496113_0344326 Ga0496113_0344326_395_826 135
73 3300049574 Ga0501038_0793962 Ga0501038_0793962_219_659 135
74 3300049680 Ga0501250_084465 Ga0501250_084465_44_472 135
75 3300049775 Ga0501279_012574 Ga0501279_012574_689_1117 135
76 3300049775 Ga0501279_075038 Ga0501279_075038_48_485 135
77 3300030736 Ga0316180_1073846 Ga0316180_10738462 140
78 iso_pu_bacteria 2929154850 2929158993 140
79 3300005367 Ga0070667_100961306 Ga0070667_1009613062 141
80 3300005842 Ga0068858_101590191 Ga0068858_1015901912 141
81 3300005843 Ga0068860_101851735 Ga0068860_1018517351 141
82 3300009176 Ga0105242_10289212 Ga0105242_102892122 141
83 3300013308 Ga0157375_10205227 Ga0157375_102052271 141
84 3300028381 Ga0268264_11787378 Ga0268264_117873781 141
85 3300049570 Ga0501033_0716613 Ga0501033_0716613_91_528 141
86 3300003322 rootL2_10135615 rootL2_101356152 142
87 3300031548 Ga0307408_100275089 Ga0307408_1002750892 142
88 3300032005 Ga0307411_10057340 Ga0307411_100573403 142
89 3300042876 Ga0451577_0000002 Ga0451577_0000002_485338_485772 143
90 3300044673 Ga0453683_0000003 Ga0453683_0000003_485338_485772 143
91 3300044712 Ga0453684_0000002 Ga0453684_0000002_1245604_1246038 143
92 3300044712 Ga0453684_0138420 Ga0453684_0138420_2357_2794 143
93 3300045051 Ga0451576_0000004 Ga0451576_0000004_872244_872678 143
94 3300045051 Ga0451576_0165004 Ga0451576_0165004_379_816 143
95 3300003316 rootH1_10048066 rootH1_100480662 144
96 3300003320 rootH2_10020112 rootH2_100201125 144
97 3300005335 Ga0070666_10169219 Ga0070666_101692192 144
98 3300005343 Ga0070687_100161916 Ga0070687_1001619162 144
99 3300005364 Ga0070673_100535649 Ga0070673_1005356492 144
100 3300005367 Ga0070667_100489699 Ga0070667_1004896992 144
101 3300005445 Ga0070708_100141695 Ga0070708_1001416954 144
102 3300005456 Ga0070678_101024326 Ga0070678_1010243261 144
103 3300005459 Ga0068867_100201180 Ga0068867_1002011802 144
104 3300005468 Ga0070707_100103823 Ga0070707_1001038231 144
105 3300005518 Ga0070699_100468709 Ga0070699_1004687091 144
106 3300005535 Ga0070684_100245197 Ga0070684_1002451972 144
107 3300005536 Ga0070697_100050385 Ga0070697_1000503852 144
108 3300005614 Ga0068856_100019965 Ga0068856_1000199653 144
109 3300005842 Ga0068858_100289442 Ga0068858_1002894422 144
110 3300005843 Ga0068860_102316950 Ga0068860_1023169501 144
111 3300006846 Ga0075430_100032771 Ga0075430_1000327712 144
112 3300006852 Ga0075433_10956758 Ga0075433_109567582 144
113 3300009094 Ga0111539_10007510 Ga0111539_100075103 144
114 3300009094 Ga0111539_10252790 Ga0111539_102527902 144
115 3300009177 Ga0105248_11084150 Ga0105248_110841501 144
116 3300009553 Ga0105249_10855144 Ga0105249_108551442 144
117 3300011119 Ga0105246_11378460 Ga0105246_113784601 144
118 3300013105 Ga0157369_10109554 Ga0157369_101095543 144
119 3300013306 Ga0163162_10047701 Ga0163162_100477014 144
120 3300013306 Ga0163162_10420575 Ga0163162_104205752 144
121 3300014326 Ga0157380_11534153 Ga0157380_115341531 144
122 3300017792 Ga0163161_10122102 Ga0163161_101221022 144
123 3300025903 Ga0207680_10075767 Ga0207680_100757673 144
124 3300025918 Ga0207662_10439633 Ga0207662_104396331 144
125 3300025944 Ga0207661_10001368 Ga0207661_1000136810 144
126 3300025960 Ga0207651_11087006 Ga0207651_110870062 144
127 3300026041 Ga0207639_10754970 Ga0207639_107549702 144
128 3300026088 Ga0207641_11334940 Ga0207641_113349402 144
129 3300026089 Ga0207648_10083192 Ga0207648_100831923 144
130 3300027907 Ga0207428_10014351 Ga0207428_100143516 144
131 3300028381 Ga0268264_12002917 Ga0268264_120029171 144
132 3300028573 Ga0265334_10155481 Ga0265334_101554811 144
133 3300028794 Ga0307515_10000001 Ga0307515_100000011534 144
134 3300031548 Ga0307408_100000505 Ga0307408_10000050521 144
135 3300031548 Ga0307408_100000523 Ga0307408_10000052316 144
136 3300031731 Ga0307405_10551481 Ga0307405_105514811 144
137 3300031911 Ga0307412_10030125 Ga0307412_100301253 144
138 3300031995 Ga0307409_100152240 Ga0307409_1001522404 144
139 3300032002 Ga0307416_100174860 Ga0307416_1001748601 144
140 3300035091 Ga0373951_0003167 Ga0373951_0003167_1104_1538 144
141 3300036401 Ga0373937_0035578 Ga0373937_0035578_100_537 144
142 3300037471 Ga0395905_0587065 Ga0395905_0587065_348_782 144
143 3300041411 Ga0439466_0082700 Ga0439466_0082700_418_861 144
144 3300041486 Ga0451807_0151585 Ga0451807_0151585_25_462 144
145 3300041486 Ga0451807_0815295 Ga0451807_0815295_27_461 144
146 3300041486 Ga0451807_1407617 Ga0451807_1407617_353_793 144
147 3300041501 Ga0451845_0741344 Ga0451845_0741344_214_651 144
148 3300041997 Ga0439431_0011747 Ga0439431_0011747_1104_1547 144
149 3300042014 Ga0439457_030904 Ga0439457_030904_670_1110 144
150 3300042016 Ga0439463_116388 Ga0439463_116388_214_651 144
151 3300042115 Ga0450911_001800 Ga0450911_001800_1287_1724 144
152 3300042876 Ga0451577_0004832 Ga0451577_0004832_13602_14039 144
153 3300042876 Ga0451577_0021627 Ga0451577_0021627_1612_2049 144
154 3300042876 Ga0451577_0101594 Ga0451577_0101594_983_1420 144
155 3300042876 Ga0451577_0218361 Ga0451577_0218361_240_677 144
156 3300042876 Ga0451577_0359219 Ga0451577_0359219_417_854 144
157 3300044673 Ga0453683_0140806 Ga0453683_0140806_302_739 144
158 3300044712 Ga0453684_0001369 Ga0453684_0001369_15603_16040 144
159 3300044712 Ga0453684_0005549 Ga0453684_0005549_2749_3189 144
160 3300044712 Ga0453684_0017284 Ga0453684_0017284_5964_6401 144
161 3300044712 Ga0453684_0063330 Ga0453684_0063330_1794_2231 144
162 3300044712 Ga0453684_0156290 Ga0453684_0156290_441_878 144
163 3300044712 Ga0453684_0334330 Ga0453684_0334330_406_843 144
164 3300044712 Ga0453684_0608244 Ga0453684_0608244_279_716 144
165 3300044712 Ga0453684_0716333 Ga0453684_0716333_106_543 144
166 3300044712 Ga0453684_0860793 Ga0453684_0860793_420_857 144
167 3300045051 Ga0451576_0043743 Ga0451576_0043743_3943_4410 144
168 3300045051 Ga0451576_0141843 Ga0451576_0141843_445_882 144
169 3300045051 Ga0451576_0477282 Ga0451576_0477282_835_1272 144
170 3300046471 Ga0495650_0116343 Ga0495650_0116343_117_557 144
171 3300046477 Ga0495664_0306230 Ga0495664_0306230_375_812 144
172 3300046499 Ga0495594_0338911 Ga0495594_0338911_100_537 144
173 3300048917 Ga0496114_1403114 Ga0496114_1403114_122_559 144
174 3300048925 Ga0496122_0181580 Ga0496122_0181580_54_491 144
175 3300048927 Ga0496124_0138872 Ga0496124_0138872_85_522 144
176 3300048928 Ga0496125_0004054 Ga0496125_0004054_5052_5489 144
177 3300048928 Ga0496125_0024932 Ga0496125_0024932_1808_2245 144
178 3300048928 Ga0496125_0089069 Ga0496125_0089069_1722_2159 144
179 3300048929 Ga0496126_0058807 Ga0496126_0058807_1758_2195 144
180 3300048929 Ga0496126_0156914 Ga0496126_0156914_917_1354 144
181 3300049571 Ga0501034_0876541 Ga0501034_0876541_279_740 144
182 3300049586 Ga0501070_0217742 Ga0501070_0217742_27_464 144
183 3300049649 Ga0501198_017290 Ga0501198_017290_423_860 144
184 3300049675 Ga0501243_000576 Ga0501243_000576_529_963 144
185 3300049744 Ga0501083_0003704 Ga0501083_0003704_108_590 144
186 3300049744 Ga0501083_0005532 Ga0501083_0005532_4400_4837 144
187 3300050509 nmdc:mga0qj67_240781_c1 nmdc:mga0qj67_240781_c1_316_753 144
188 3300050511 nmdc:mga08y16_4963_c1 nmdc:mga08y16_4963_c1_12649_13086 144
189 3300050511 nmdc:mga08y16_93253_c1 nmdc:mga08y16_93253_c1_2416_2853 144
190 3300053117 Ga0500593_146466 Ga0500593_146466_322_762 144
191 3300053156 Ga0500622_0002747 Ga0500622_0002747_20_457 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

16

154

0.84

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

17

154

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.9055 1 141
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8801 1 141
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.817 2 141
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.8086 4 137
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8055 2 141
ID Description Score Start End Superfamily
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9425 89 141 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8935 8 141 3.10.180.10
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8871 83 141 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8659 8 141 3.10.180.10
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8608 83 141 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7L9BEZ4-F1-model_v4 VOC family protein 0.9825 1 144
AF-A0A520IFK4-F1-model_v4 VOC family protein 0.9806 16 143
AF-A0A7L9BEZ4-F1-model_v4 VOC family protein 0.9758 1 144
AF-N9VET0-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9752 1 144 GO:0008168
GO:0032259
AF-A0A7Y8NT19-F1-model_v4 VOC family protein 0.9743 1 141

Feature Viewer

pLDDT pTM Quality
93.49 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map