F294642

General Info

Members Datasets Scaffolds Average Seq Length
191 150 382 257

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0026387|Ga0496116_0026387_1921_3081
Length 299
Sequence MNVIITGASGGIGAEVAFQLASRTDVANVGLIARRADALSAVAHRCSQRSNDTACDLAEEKVVTYVGDVSDEKVVEAAVSFFCTKFKDRIDVLINNVGRGDNKKPSELTDDDIRSMMEVNVMTAVRCIRRVLPLMRAAAPGGRGHIINVSSLLGRISSGPSCPGYSASKHFLNAYTSSLRAELKGTHPNIVVSTVSPGPVLTDFGINAGFVPAPSIATAPVQSPSANHYPRKGKCPGEVWPPTQYPPKQPVHEAAAAIVFCVVNRVEEMYTAPGLRSRVLRYMEDLAKDYCPTMNRLVG

Samples

Sample ID Description Type Environment
1 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
87 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
99 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
143 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
144 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
145 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
146 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
147 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.05
Rhizosphere 97.91
Stem 0
Stem Tuber 0
Unclassified 12.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496116_0026387 3300048919 Bacteria 4251
2 Ga0065712_10069341 3300005290 Bacteria 7496
3 Ga0070658_10004601 3300005327 Bacteria 11209
4 Ga0070670_100010343 3300005331 Bacteria 7962
5 Ga0070666_10265758 3300005335 Unclassified 1217
6 Ga0070680_100003398 3300005336 Bacteria 11885
7 Ga0070660_100157235 3300005339 Unclassified 1830
8 Ga0070689_100228327 3300005340 Unclassified 1529
9 Ga0070687_100019011 3300005343 Bacteria 3190
10 Ga0070661_100698785 3300005344 Unclassified 826
11 Ga0070675_100008090 3300005354 Bacteria 8152
12 Ga0070674_100036889 3300005356 Bacteria 3285
13 Ga0070673_100042794 3300005364 Bacteria 3494
14 Ga0070688_100082205 3300005365 Bacteria 2087
15 Ga0070659_100286423 3300005366 Bacteria 1371
16 Ga0070667_100057269 3300005367 Bacteria 3294
17 Ga0070694_100009749 3300005444 Bacteria 5899
18 Ga0068867_100309066 3300005459 Bacteria 1306
19 Ga0070706_100480169 3300005467 Bacteria 1156
20 Ga0070707_100020567 3300005468 Bacteria 6229
21 Ga0070707_100179947 3300005468 Bacteria 2061
22 Ga0070707_100756106 3300005468 Bacteria 935
23 Ga0070698_100052115 3300005471 Bacteria 4165
24 Ga0070698_100125931 3300005471 Bacteria 2519
25 Ga0070698_100313456 3300005471 Bacteria 1499
26 Ga0070679_100003830 3300005530 Bacteria 13807
27 Ga0068853_100000844 3300005539 Bacteria 21404
28 Ga0070672_100076445 3300005543 Bacteria 2675
29 Ga0070704_100211083 3300005549 Bacteria 1573
30 Ga0068855_100053497 3300005563 Unclassified 4750
31 Ga0068855_100121378 3300005563 Bacteria 2991
32 Ga0070664_100039304 3300005564 Bacteria 3986
33 Ga0070702_100150132 3300005615 Bacteria 1495
34 Ga0068852_100446264 3300005616 Unclassified 1280
35 Ga0068859_100033080 3300005617 Bacteria 5194
36 Ga0068861_100131744 3300005719 Bacteria 2030
37 Ga0068861_100209591 3300005719 Bacteria 1641
38 Ga0068870_10094743 3300005840 Bacteria 1676
39 Ga0068863_100207046 3300005841 Bacteria 1888
40 Ga0068863_100277606 3300005841 Bacteria 1623
41 Ga0068862_100082480 3300005844 Bacteria 2790
42 Ga0081539_10028891 3300005985 Bacteria 3479
43 Ga0070717_10494784 3300006028 Bacteria 1105
44 Ga0068871_100144249 3300006358 Bacteria 2026
45 Ga0075428_100580911 3300006844 Bacteria 1197
46 Ga0075433_10022523 3300006852 Bacteria 5288
47 Ga0075429_100067231 3300006880 Bacteria 3119
48 Ga0097620_100033078 3300006931 Bacteria 5194
49 Ga0075435_100378939 3300007076 Unclassified 1215
50 Ga0105240_10000652 3300009093 Bacteria 63981
51 Ga0105240_10365456 3300009093 Bacteria 1633
52 Ga0114129_10025246 3300009147 Bacteria 8419
53 Ga0105241_10407589 3300009174 Bacteria 1194
54 Ga0105248_10239637 3300009177 Bacteria 2042
55 Ga0105237_10000139 3300009545 Bacteria 102251
56 Ga0105238_10003394 3300009551 Bacteria 15899
57 Ga0105238_10006173 3300009551 Bacteria 11899
58 Ga0105238_10753455 3300009551 Unclassified 988
59 Ga0105249_10194099 3300009553 Unclassified 1983
60 Ga0105239_10404841 3300010375 Bacteria 1544
61 Ga0157375_10142709 3300013308 Bacteria 2523
62 Ga0207680_10159486 3300025903 Bacteria 1511
63 Ga0207643_10323043 3300025908 Unclassified 964
64 Ga0207705_10018780 3300025909 Bacteria 4946
65 Ga0207684_10377746 3300025910 Bacteria 1219
66 Ga0207695_10003829 3300025913 Bacteria 20851
67 Ga0207671_10000120 3300025914 Bacteria 120786
68 Ga0207660_10007176 3300025917 Bacteria 7214
69 Ga0207662_10072726 3300025918 Bacteria 2084
70 Ga0207657_10394083 3300025919 Bacteria 1089
71 Ga0207652_10004324 3300025921 Bacteria 11576
72 Ga0207652_10326103 3300025921 Bacteria 1386
73 Ga0207646_10021299 3300025922 Bacteria 5991
74 Ga0207646_10258175 3300025922 Bacteria 1575
75 Ga0207694_10002750 3300025924 Bacteria 14206
76 Ga0207650_10010303 3300025925 Bacteria 6407
77 Ga0207659_10019584 3300025926 Unclassified 4458
78 Ga0207690_10250064 3300025932 Bacteria 1369
79 Ga0207670_10221018 3300025936 Unclassified 1450
80 Ga0207669_10502251 3300025937 Unclassified 970
81 Ga0207691_10013673 3300025940 Bacteria 7755
82 Ga0207691_10178932 3300025940 Unclassified 1854
83 Ga0207711_10245805 3300025941 Unclassified 1642
84 Ga0207661_10110959 3300025944 Unclassified 2320
85 Ga0207679_10052610 3300025945 Bacteria 2987
86 Ga0207712_10141667 3300025961 Unclassified 1846
87 Ga0207640_10417185 3300025981 Bacteria 1097
88 Ga0207658_10459001 3300025986 Unclassified 1129
89 Ga0207639_10001730 3300026041 Bacteria 14701
90 Ga0207702_10072014 3300026078 Bacteria 2978
91 Ga0207675_100139749 3300026118 Bacteria 2300
92 Ga0207675_101135881 3300026118 Bacteria 801
93 Ga0268265_10082593 3300028380 Unclassified 2541
94 Ga0265319_1068890 3300028563 Bacteria 1136
95 Ga0265318_10000532 3300028577 Bacteria 27256
96 Ga0265336_10020058 3300028666 Bacteria 2150
97 Ga0265338_10008080 3300028800 Bacteria 12863
98 Ga0265338_10249622 3300028800 Bacteria 1310
99 Ga0265330_10000455 3300031235 Bacteria 27284
100 Ga0265332_10000484 3300031238 Bacteria 27573
101 Ga0265332_10001049 3300031238 Bacteria 16185
102 Ga0265328_10004994 3300031239 Bacteria 5717
103 Ga0265320_10000021 3300031240 Bacteria 179499
104 Ga0265320_10054292 3300031240 Unclassified 1933
105 Ga0265320_10059200 3300031240 Bacteria 1832
106 Ga0265329_10002225 3300031242 Bacteria 8937
107 Ga0265340_10181209 3300031247 Bacteria 952
108 Ga0265339_10051956 3300031249 Bacteria 2234
109 Ga0265339_10073484 3300031249 Bacteria 1818
110 Ga0265331_10000277 3300031250 Bacteria 56887
111 Ga0265331_10077942 3300031250 Bacteria 1543
112 Ga0265327_10006438 3300031251 Bacteria 9386
113 Ga0265316_10049028 3300031344 Bacteria 3328
114 Ga0265313_10000379 3300031595 Bacteria 48042
115 Ga0265313_10004998 3300031595 Bacteria 9919
116 Ga0265313_10010350 3300031595 Bacteria 5915
117 Ga0265313_10031302 3300031595 Bacteria 2729
118 Ga0316579_10133263 3300031691 Unclassified 1197
119 Ga0265314_10001351 3300031711 Bacteria 27707
120 Ga0265314_10005364 3300031711 Bacteria 11589
121 Ga0265314_10008331 3300031711 Bacteria 8889
122 Ga0265314_10012063 3300031711 Bacteria 7082
123 Ga0265342_10000165 3300031712 Bacteria 74061
124 Ga0265342_10001940 3300031712 Bacteria 18535
125 Ga0265342_10005846 3300031712 Bacteria 9289
126 Ga0316578_10000914 3300031728 Bacteria 11158
127 Ga0316577_10033709 3300031733 Bacteria 2861
128 Ga0307413_10143399 3300031824 Bacteria 1654
129 Ga0307413_10164626 3300031824 Bacteria 1562
130 Ga0307410_10070805 3300031852 Bacteria 2417
131 Ga0307406_10423101 3300031901 Bacteria 1062
132 Ga0307407_10137120 3300031903 Bacteria 1574
133 Ga0307412_10066483 3300031911 Bacteria 2444
134 Ga0307416_100092725 3300032002 Bacteria 2599
135 Ga0307416_100546759 3300032002 Bacteria 1231
136 Ga0307415_100109386 3300032126 Bacteria 2047
137 Ga0316585_10121815 3300032137 Unclassified 859
138 Ga0373934_0105725 3300035086 Bacteria 1140
139 Ga0373954_0028308 3300035118 Bacteria 2576
140 Ga0373956_0026156 3300035119 Bacteria 2527
141 Ga0373957_0034025 3300035120 Bacteria 1884
142 Ga0373957_0115012 3300035120 Bacteria 1086
143 Ga0373946_0100783 3300035171 Bacteria 1295
144 Ga0373955_0015354 3300035172 Bacteria 3748
145 Ga0373935_0101699 3300035692 Bacteria 1896
146 Ga0373927_0352063 3300035695 Bacteria 970
147 Ga0373947_0211822 3300035725 Bacteria 1271
148 Ga0373937_0089665 3300036401 Bacteria 2847
149 Ga0373937_0174024 3300036401 Bacteria 2020
150 Ga0373937_0345307 3300036401 Bacteria 1409
151 Ga0316584_0002904 3300036712 Bacteria 11008
152 Ga0451853_0440084 3300041512 Unclassified 863
153 Ga0451577_0210886 3300042876 Bacteria 1754
154 Ga0451576_0120922 3300045051 Bacteria 2726
155 Ga0495592_0142792 3300046454 Unclassified 1663
156 Ga0495629_0000024 3300046459 Bacteria 136884
157 Ga0495653_0103087 3300046463 Bacteria 2064
158 Ga0495608_0009919 3300046511 Bacteria 6649
159 Ga0495618_0000702 3300046514 Bacteria 23319
160 Ga0495628_0281707 3300046516 Bacteria 1234
161 Ga0495630_0035138 3300046517 Bacteria 3745
162 Ga0495630_0051644 3300046517 Bacteria 3077
163 Ga0495630_0154734 3300046517 Bacteria 1745
164 Ga0495652_0242899 3300046529 Bacteria 1339
165 Ga0495640_0122453 3300046533 Bacteria 1689
166 Ga0495667_0045065 3300046559 Bacteria 2921
167 Ga0495667_0164253 3300046559 Bacteria 1427
168 Ga0495635_0025692 3300046663 Bacteria 4103
169 Ga0495613_0038711 3300046689 Bacteria 3534
170 Ga0495600_0167771 3300046809 Bacteria 1418
171 Ga0495604_0190087 3300047317 Bacteria 1431
172 Ga0495674_0057508 3300047319 Bacteria 3403
173 Ga0495674_0126625 3300047319 Bacteria 2154
174 Ga0495680_0059464 3300047322 Bacteria 2950
175 Ga0495680_0205789 3300047322 Bacteria 1410
176 Ga0495680_0362419 3300047322 Bacteria 1007
177 Ga0495684_0065857 3300047471 Bacteria 2754
178 Ga0495684_0189031 3300047471 Bacteria 1523
179 Ga0495602_0158390 3300048088 Bacteria 1771
180 Ga0496101_0136387 3300048904 Bacteria 1868
181 Ga0496115_0109733 3300048918 Bacteria 2266
182 Ga0501223_008305 3300049663 Bacteria 2117
183 Ga0501243_009155 3300049675 Bacteria 1537
184 Ga0501249_015754 3300049679 Bacteria 1618
185 Ga0501221_002307 3300049704 Bacteria 3171
186 Ga0501225_0008868 3300049705 Bacteria 2876
187 Ga0501270_001139 3300049767 Bacteria 2468
188 nmdc:mga09592_397849_c1 3300050508 Bacteria 1191
189 nmdc:mga0n895_665155_c1 3300050512 Bacteria 1039
190 nmdc:mga0n895_68370_c1 3300050512 Bacteria 3519
191 nmdc:mga0rr50_264738_c1 3300050513 Bacteria 1431
192 Ga0496116_0026387
193 Ga0065712_10069341
194 Ga0070658_10004601
195 Ga0070670_100010343
196 Ga0070666_10265758
197 Ga0070680_100003398
198 Ga0070660_100157235
199 Ga0070689_100228327
200 Ga0070687_100019011
201 Ga0070661_100698785
202 Ga0070675_100008090
203 Ga0070674_100036889
204 Ga0070673_100042794
205 Ga0070688_100082205
206 Ga0070659_100286423
207 Ga0070667_100057269
208 Ga0070694_100009749
209 Ga0068867_100309066
210 Ga0070706_100480169
211 Ga0070707_100020567
212 Ga0070707_100179947
213 Ga0070707_100756106
214 Ga0070698_100052115
215 Ga0070698_100125931
216 Ga0070698_100313456
217 Ga0070679_100003830
218 Ga0068853_100000844
219 Ga0070672_100076445
220 Ga0070704_100211083
221 Ga0068855_100053497
222 Ga0068855_100121378
223 Ga0070664_100039304
224 Ga0070702_100150132
225 Ga0068852_100446264
226 Ga0068859_100033080
227 Ga0068861_100131744
228 Ga0068861_100209591
229 Ga0068870_10094743
230 Ga0068863_100207046
231 Ga0068863_100277606
232 Ga0068862_100082480
233 Ga0081539_10028891
234 Ga0070717_10494784
235 Ga0068871_100144249
236 Ga0075428_100580911
237 Ga0075433_10022523
238 Ga0075429_100067231
239 Ga0097620_100033078
240 Ga0075435_100378939
241 Ga0105240_10000652
242 Ga0105240_10365456
243 Ga0114129_10025246
244 Ga0105241_10407589
245 Ga0105248_10239637
246 Ga0105237_10000139
247 Ga0105238_10003394
248 Ga0105238_10006173
249 Ga0105238_10753455
250 Ga0105249_10194099
251 Ga0105239_10404841
252 Ga0157375_10142709
253 Ga0207680_10159486
254 Ga0207643_10323043
255 Ga0207705_10018780
256 Ga0207684_10377746
257 Ga0207695_10003829
258 Ga0207671_10000120
259 Ga0207660_10007176
260 Ga0207662_10072726
261 Ga0207657_10394083
262 Ga0207652_10004324
263 Ga0207652_10326103
264 Ga0207646_10021299
265 Ga0207646_10258175
266 Ga0207694_10002750
267 Ga0207650_10010303
268 Ga0207659_10019584
269 Ga0207690_10250064
270 Ga0207670_10221018
271 Ga0207669_10502251
272 Ga0207691_10013673
273 Ga0207691_10178932
274 Ga0207711_10245805
275 Ga0207661_10110959
276 Ga0207679_10052610
277 Ga0207712_10141667
278 Ga0207640_10417185
279 Ga0207658_10459001
280 Ga0207639_10001730
281 Ga0207702_10072014
282 Ga0207675_100139749
283 Ga0207675_101135881
284 Ga0268265_10082593
285 Ga0265319_1068890
286 Ga0265318_10000532
287 Ga0265336_10020058
288 Ga0265338_10008080
289 Ga0265338_10249622
290 Ga0265330_10000455
291 Ga0265332_10000484
292 Ga0265332_10001049
293 Ga0265328_10004994
294 Ga0265320_10000021
295 Ga0265320_10054292
296 Ga0265320_10059200
297 Ga0265329_10002225
298 Ga0265340_10181209
299 Ga0265339_10051956
300 Ga0265339_10073484
301 Ga0265331_10000277
302 Ga0265331_10077942
303 Ga0265327_10006438
304 Ga0265316_10049028
305 Ga0265313_10000379
306 Ga0265313_10004998
307 Ga0265313_10010350
308 Ga0265313_10031302
309 Ga0316579_10133263
310 Ga0265314_10001351
311 Ga0265314_10005364
312 Ga0265314_10008331
313 Ga0265314_10012063
314 Ga0265342_10000165
315 Ga0265342_10001940
316 Ga0265342_10005846
317 Ga0316578_10000914
318 Ga0316577_10033709
319 Ga0307413_10143399
320 Ga0307413_10164626
321 Ga0307410_10070805
322 Ga0307406_10423101
323 Ga0307407_10137120
324 Ga0307412_10066483
325 Ga0307416_100092725
326 Ga0307416_100546759
327 Ga0307415_100109386
328 Ga0316585_10121815
329 Ga0373934_0105725
330 Ga0373954_0028308
331 Ga0373956_0026156
332 Ga0373957_0034025
333 Ga0373957_0115012
334 Ga0373946_0100783
335 Ga0373955_0015354
336 Ga0373935_0101699
337 Ga0373927_0352063
338 Ga0373947_0211822
339 Ga0373937_0089665
340 Ga0373937_0174024
341 Ga0373937_0345307
342 Ga0316584_0002904
343 Ga0451853_0440084
344 Ga0451577_0210886
345 Ga0451576_0120922
346 Ga0495592_0142792
347 Ga0495629_0000024
348 Ga0495653_0103087
349 Ga0495608_0009919
350 Ga0495618_0000702
351 Ga0495628_0281707
352 Ga0495630_0035138
353 Ga0495630_0051644
354 Ga0495630_0154734
355 Ga0495652_0242899
356 Ga0495640_0122453
357 Ga0495667_0045065
358 Ga0495667_0164253
359 Ga0495635_0025692
360 Ga0495613_0038711
361 Ga0495600_0167771
362 Ga0495604_0190087
363 Ga0495674_0057508
364 Ga0495674_0126625
365 Ga0495680_0059464
366 Ga0495680_0205789
367 Ga0495680_0362419
368 Ga0495684_0065857
369 Ga0495684_0189031
370 Ga0495602_0158390
371 Ga0496101_0136387
372 Ga0496115_0109733
373 Ga0501223_008305
374 Ga0501243_009155
375 Ga0501249_015754
376 Ga0501221_002307
377 Ga0501225_0008868
378 Ga0501270_001139
379 nmdc:mga09592_397849_c1
380 nmdc:mga0n895_665155_c1
381 nmdc:mga0n895_68370_c1
382 nmdc:mga0rr50_264738_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

1

209

0.92

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

3

86

0.86

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

7

215

0.8

PF08659

KR

KR domain

2

191

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9316 3 228
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9201 3 228
8g9v-assembly3.cif.gz_F crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.9199 4 237
8g9v-assembly4.cif.gz_G crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.9173 3 241
8g9v-assembly1.cif.gz_A crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.9168 4 238
ID Description Score Start End Superfamily
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9717 4 87 3.40.50.720
af_Q0D3U8_30_207_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9521 4 164 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9392 4 83 3.40.50.720
af_K7KVW4_1_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9368 30 189 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9357 4 184 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1L6M286-F1-model_v4 deleted 0.9911 3 245
AF-A0A7C7ZS07-F1-model_v4 SDR family oxidoreductase 0.9752 3 193 GO:0016491
AF-A0A7V9PH19-F1-model_v4 SDR family oxidoreductase 0.975 1 248 GO:0016020
GO:0016491
AF-A0A7V9PH19-F1-model_v4 SDR family oxidoreductase 0.9711 1 248 GO:0016020
GO:0016491
AF-A0A384AZA9-F1-model_v4 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit (Quinone reductase CBR4) 0.9636 3 183 GO:0006633
GO:0016616
GO:0048038

Map