F294589

General Info

Members Datasets Scaffolds Average Seq Length
191 153 382 260

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0086126|Ga0495676_0086126_1195_2088
Length 297
Sequence MTPELMKAGAQIKAEHERKVAASVGQSGGRQASYSRIATPGELDVTHGAILYLDDITVSFDGFKALNALSLSISAGEMRCIIGPNGAGKTTMMDVITGKTRPDLGKAFFGSTIDLLRMRENEIASIGIGRKFQKPTVFEQLSVXXNLELALKADRGVRSSMFFRLNGEQLDRIGAMLTLIHLKDSAQRVAGLLSHGQKQWLEIGMLLMQDPKLLLLDEPVAGMTDEETERTAELFLSLEGNHSLVVVEHDMKFIGELTQNGKNGKKVTVLHEGSVLAEGLLSEVQANEKVVEVYLGR

Samples

Sample ID Description Type Environment
1 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
70 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
71 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
75 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
84 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
122 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
127 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
128 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
137 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
138 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
139 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
140 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
141 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
142 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
143 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
144 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
145 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
146 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
147 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
149 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
150 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
151 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
152 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
153 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.76
Metatranscriptomes 2.62
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.71
Nodule 0
Rhizoplane 4.19
Rhizosphere 74.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495676_0086126 3300047321 Bacteria 2365
2 JGI25150J39212_1011159 3300002774 Bacteria 1639
3 rootH1_10076353 3300003323 Bacteria 1354
4 Ga0055528_1037964 3300003790 Bacteria 1123
5 Ga0055530_10005768 3300003791 Bacteria 5754
6 Ga0065165_1003263 3300005262 Bacteria 11713
7 Ga0070676_10242563 3300005328 Bacteria 1199
8 Ga0070677_10048271 3300005333 Bacteria 1710
9 Ga0070669_100115742 3300005353 Bacteria 2040
10 Ga0070667_100115846 3300005367 Bacteria 2327
11 Ga0070667_100308653 3300005367 Bacteria 1426
12 Ga0070694_100004240 3300005444 Bacteria 8626
13 Ga0070706_100007038 3300005467 Bacteria 10606
14 Ga0070706_100037315 3300005467 Bacteria 4489
15 Ga0070706_100340238 3300005467 Bacteria 1399
16 Ga0070707_100055685 3300005468 Bacteria 3792
17 Ga0070707_100062322 3300005468 Bacteria 3577
18 Ga0070699_100155190 3300005518 Bacteria 2026
19 Ga0070672_100671219 3300005543 Bacteria 906
20 Ga0068855_100441621 3300005563 Bacteria 1421
21 Ga0068856_100314295 3300005614 Bacteria 1584
22 Ga0068852_100283534 3300005616 Bacteria 1598
23 Ga0068859_100018861 3300005617 Bacteria 6932
24 Ga0068864_100011231 3300005618 Bacteria 7401
25 Ga0068858_100042969 3300005842 Bacteria 4191
26 Ga0068858_100098072 3300005842 Bacteria 2732
27 Ga0068860_100838061 3300005843 Bacteria 934
28 Ga0075365_10117181 3300006038 Bacteria 1834
29 Ga0075368_10085950 3300006042 Bacteria 1283
30 Ga0075364_10019359 3300006051 Bacteria 4272
31 Ga0075367_10064821 3300006178 Bacteria 2186
32 Ga0075367_10103280 3300006178 Bacteria 1744
33 Ga0075367_10150744 3300006178 Bacteria 1443
34 Ga0075428_100001225 3300006844 Bacteria 27466
35 Ga0075428_100604596 3300006844 Bacteria 1171
36 Ga0075430_100001806 3300006846 Bacteria 17507
37 Ga0075431_100053149 3300006847 Bacteria 4176
38 Ga0075433_10301226 3300006852 Bacteria 1420
39 Ga0075434_100427451 3300006871 Bacteria 1346
40 Ga0075429_100009506 3300006880 Bacteria 8436
41 Ga0068865_100341673 3300006881 Bacteria 1210
42 Ga0097620_100018861 3300006931 Bacteria 6932
43 Ga0099794_10319617 3300007265 Bacteria 805
44 Ga0105240_10007884 3300009093 Bacteria 15355
45 Ga0105240_10064944 3300009093 Bacteria 4532
46 Ga0111539_10021745 3300009094 Bacteria 7887
47 Ga0111539_10043629 3300009094 Bacteria 5375
48 Ga0111539_10526064 3300009094 Bacteria 1378
49 Ga0114129_10001981 3300009147 Bacteria 28014
50 Ga0114129_10009453 3300009147 Bacteria 13896
51 Ga0114129_10015559 3300009147 Bacteria 10815
52 Ga0114129_10199889 3300009147 Bacteria 2708
53 Ga0105242_10070625 3300009176 Bacteria 2896
54 Ga0105242_10385992 3300009176 Bacteria 1303
55 Ga0105238_10082781 3300009551 Bacteria 3199
56 Ga0105239_10590628 3300010375 Bacteria 1266
57 Ga0157369_10256448 3300013105 Bacteria 1824
58 Ga0163163_10053103 3300014325 Bacteria 4000
59 Ga0157380_10132932 3300014326 Bacteria 2125
60 Ga0157379_10024153 3300014968 Bacteria 5394
61 Ga0213876_10009617 3300021384 Bacteria 5202
62 Ga0209673_1012966 3300025273 Bacteria 3318
63 Ga0209050_1000118 3300025298 Bacteria 202586
64 Ga0209051_1007201 3300025303 Bacteria 6120
65 Ga0209257_1034407 3300025304 Bacteria 1581
66 Ga0207645_10250878 3300025907 Bacteria 1171
67 Ga0207684_10027425 3300025910 Bacteria 4854
68 Ga0207684_10033660 3300025910 Bacteria 4359
69 Ga0207684_10178424 3300025910 Bacteria 1831
70 Ga0207695_10064857 3300025913 Bacteria 3758
71 Ga0207695_10144685 3300025913 Bacteria 2322
72 Ga0207662_10262223 3300025918 Bacteria 1138
73 Ga0207649_10105791 3300025920 Bacteria 1870
74 Ga0207646_10060073 3300025922 Bacteria 3395
75 Ga0207646_10102450 3300025922 Bacteria 2566
76 Ga0207659_10023446 3300025926 Bacteria 4119
77 Ga0207686_10197784 3300025934 Bacteria 1437
78 Ga0207704_10487336 3300025938 Bacteria 991
79 Ga0207667_10330579 3300025949 Bacteria 1556
80 Ga0207667_10545488 3300025949 Bacteria 1173
81 Ga0207703_10007445 3300026035 Bacteria 8694
82 Ga0207703_10047248 3300026035 Bacteria 3470
83 Ga0207678_10075600 3300026067 Bacteria 2885
84 Ga0207702_10259743 3300026078 Bacteria 1635
85 Ga0207648_10423617 3300026089 Bacteria 1209
86 Ga0207683_10030992 3300026121 Bacteria 4639
87 Ga0207698_10003426 3300026142 Bacteria 9544
88 Ga0207698_10353088 3300026142 Bacteria 1390
89 Ga0207428_10029505 3300027907 Bacteria 4546
90 Ga0207428_10152068 3300027907 Bacteria 1761
91 Ga0307515_10102584 3300028794 Bacteria 3439
92 Ga0265313_10007940 3300031595 Bacteria 7130
93 Ga0307514_10042614 3300031649 Bacteria 3569
94 Ga0316579_10048564 3300031691 Bacteria 1982
95 Ga0307516_10074401 3300031730 Bacteria 3253
96 Ga0316577_10036334 3300031733 Bacteria 2755
97 Ga0316583_10102413 3300032133 Bacteria 998
98 Ga0316592_1001156 3300033524 Bacteria 4149
99 Ga0316588_1002037 3300033528 Bacteria 3457
100 Ga0316596_1002492 3300033541 Bacteria 3936
101 Ga0316596_1022131 3300033541 Bacteria 1623
102 Ga0373944_0026443 3300035089 Bacteria 1714
103 Ga0373936_0001617 3300035113 Bacteria 8236
104 Ga0373953_0061606 3300035117 Bacteria 1535
105 Ga0373943_0003667 3300035170 Bacteria 6980
106 Ga0373955_0003289 3300035172 Bacteria 7088
107 Ga0373955_0197448 3300035172 Bacteria 1197
108 Ga0373961_0024909 3300035241 Bacteria 1622
109 Ga0373924_0025525 3300035410 Bacteria 2337
110 Ga0373935_0011689 3300035692 Bacteria 5272
111 Ga0373927_0038242 3300035695 Bacteria 3115
112 Ga0373947_0007013 3300035725 Bacteria 6527
113 Ga0373937_0027669 3300036401 Bacteria 5130
114 Ga0373937_0261832 3300036401 Bacteria 1631
115 Ga0373925_0012888 3300037068 Bacteria 6056
116 Ga0395905_0000025 3300037471 Bacteria 317571
117 Ga0395905_0020336 3300037471 Bacteria 6288
118 Ga0436365_1222321 3300039437 Bacteria 5297
119 Ga0451793_1580448 3300041452 Bacteria 1952
120 Ga0451577_0005033 3300042876 Bacteria 13666
121 Ga0466969_0057197 3300044656 Bacteria 1901
122 Ga0466965_0011600 3300044683 Bacteria 4132
123 Ga0466961_0054989 3300044693 Bacteria 2538
124 Ga0466963_0126272 3300044694 Bacteria 1764
125 Ga0466964_0011366 3300044706 Bacteria 3362
126 Ga0453684_0000014 3300044712 Bacteria 993311
127 Ga0453684_0017510 3300044712 Bacteria 11094
128 Ga0453684_0041523 3300044712 Bacteria 6219
129 Ga0453684_0043976 3300044712 Bacteria 5988
130 Ga0453684_0045765 3300044712 Bacteria 5830
131 Ga0466971_0000160 3300044719 Bacteria 25173
132 Ga0466968_0085403 3300044735 Bacteria 1392
133 Ga0466970_0035311 3300044765 Bacteria 2648
134 Ga0466957_0080782 3300044842 Bacteria 2024
135 Ga0451576_0006046 3300045051 Bacteria 14943
136 Ga0466958_0118081 3300045836 Bacteria 1659
137 Ga0495638_0310849 3300046460 Bacteria 846
138 Ga0495618_0112248 3300046514 Bacteria 1745
139 Ga0495630_0003287 3300046517 Bacteria 11275
140 Ga0495630_0247580 3300046517 Bacteria 1362
141 Ga0495630_0476961 3300046517 Bacteria 956
142 Ga0495632_0049831 3300046519 Bacteria 2068
143 Ga0495634_0289880 3300046642 Bacteria 992
144 Ga0495658_0073293 3300046683 Bacteria 1993
145 Ga0495613_0072164 3300046689 Bacteria 2516
146 Ga0495674_0111949 3300047319 Bacteria 2313
147 Ga0495675_0143159 3300047444 Bacteria 1481
148 Ga0495675_0187765 3300047444 Bacteria 1263
149 Ga0496101_0431657 3300048904 Bacteria 1039
150 Ga0496102_0197205 3300048905 Bacteria 1897
151 Ga0496106_0116931 3300048909 Bacteria 2080
152 Ga0496106_0371343 3300048909 Bacteria 1149
153 Ga0496108_0545150 3300048911 Bacteria 1012
154 Ga0496109_0315273 3300048912 Bacteria 1476
155 Ga0496114_0031224 3300048917 Bacteria 4383
156 Ga0496116_0004409 3300048919 Bacteria 13450
157 Ga0496125_0011705 3300048928 Bacteria 8749
158 Ga0501081_0121096 3300049743 Bacteria 1864
159 nmdc:mga00v17_251892_c1 3300050491 Bacteria 1145
160 nmdc:mga00v17_2889_c1 3300050491 Bacteria 8810
161 nmdc:mga0yw44_158071_c1 3300050492 Bacteria 1482
162 nmdc:mga06z11_107524_c1 3300050494 Bacteria 1540
163 nmdc:mga04h51_166175_c1 3300050495 Bacteria 852
164 nmdc:mga07m45_41499_c1 3300050496 Bacteria 2577
165 nmdc:mga05p37_240504_c1 3300050507 Bacteria 2177
166 nmdc:mga05p37_349_c1 3300050507 Bacteria 49419
167 nmdc:mga05p37_52457_c1 3300050507 Bacteria 5015
168 nmdc:mga09592_3199_c1 3300050508 Bacteria 13275
169 nmdc:mga0qj67_570_c1 3300050509 Bacteria 25144
170 nmdc:mga06r32_44784_c1 3300050510 Bacteria 4215
171 nmdc:mga08y16_9194_c1 3300050511 Bacteria 10370
172 nmdc:mga0n895_324725_c1 3300050512 Bacteria 1559
173 nmdc:mga0a205_285220_c1 3300050515 Bacteria 1526
174 Ga0495612_0003967 3300053078 Bacteria 6146
175 Ga0500644_0016573 3300053088 Bacteria 2123
176 Ga0500651_0278128 3300053093 Bacteria 966
177 Ga0500650_0082686 3300053098 Bacteria 1502
178 Ga0500555_001332 3300053103 Bacteria 7753
179 Ga0500652_000443 3300053131 Bacteria 14692
180 Ga0500577_0015083 3300053142 Bacteria 2405
181 Ga0500616_0000135 3300053153 Bacteria 126795
182 Ga0500622_0000053 3300053156 Bacteria 145070
183 Ga0500645_002045 3300053730 Bacteria 9391
184 Ga0500599_005960 3300053736 Bacteria 1544
185 Ga0587070_022987 3300059491 Bacteria 1067
186 Ga0466962_0003972 3300061719 Bacteria 7081
187 2524191683 2524023129 Bacteria 6762600
188 2644302842 2643221654 Bacteria 5273570
189 2864739359 2864733723 Bacteria 6770668
190 8055228538 8055225921 Bacteria 3341787
191 8057475431 8057473075 Bacteria 5892720
192 Ga0495676_0086126
193 JGI25150J39212_1011159
194 rootH1_10076353
195 Ga0055528_1037964
196 Ga0055530_10005768
197 Ga0065165_1003263
198 Ga0070676_10242563
199 Ga0070677_10048271
200 Ga0070669_100115742
201 Ga0070667_100115846
202 Ga0070667_100308653
203 Ga0070694_100004240
204 Ga0070706_100007038
205 Ga0070706_100037315
206 Ga0070706_100340238
207 Ga0070707_100055685
208 Ga0070707_100062322
209 Ga0070699_100155190
210 Ga0070672_100671219
211 Ga0068855_100441621
212 Ga0068856_100314295
213 Ga0068852_100283534
214 Ga0068859_100018861
215 Ga0068864_100011231
216 Ga0068858_100042969
217 Ga0068858_100098072
218 Ga0068860_100838061
219 Ga0075365_10117181
220 Ga0075368_10085950
221 Ga0075364_10019359
222 Ga0075367_10064821
223 Ga0075367_10103280
224 Ga0075367_10150744
225 Ga0075428_100001225
226 Ga0075428_100604596
227 Ga0075430_100001806
228 Ga0075431_100053149
229 Ga0075433_10301226
230 Ga0075434_100427451
231 Ga0075429_100009506
232 Ga0068865_100341673
233 Ga0097620_100018861
234 Ga0099794_10319617
235 Ga0105240_10007884
236 Ga0105240_10064944
237 Ga0111539_10021745
238 Ga0111539_10043629
239 Ga0111539_10526064
240 Ga0114129_10001981
241 Ga0114129_10009453
242 Ga0114129_10015559
243 Ga0114129_10199889
244 Ga0105242_10070625
245 Ga0105242_10385992
246 Ga0105238_10082781
247 Ga0105239_10590628
248 Ga0157369_10256448
249 Ga0163163_10053103
250 Ga0157380_10132932
251 Ga0157379_10024153
252 Ga0213876_10009617
253 Ga0209673_1012966
254 Ga0209050_1000118
255 Ga0209051_1007201
256 Ga0209257_1034407
257 Ga0207645_10250878
258 Ga0207684_10027425
259 Ga0207684_10033660
260 Ga0207684_10178424
261 Ga0207695_10064857
262 Ga0207695_10144685
263 Ga0207662_10262223
264 Ga0207649_10105791
265 Ga0207646_10060073
266 Ga0207646_10102450
267 Ga0207659_10023446
268 Ga0207686_10197784
269 Ga0207704_10487336
270 Ga0207667_10330579
271 Ga0207667_10545488
272 Ga0207703_10007445
273 Ga0207703_10047248
274 Ga0207678_10075600
275 Ga0207702_10259743
276 Ga0207648_10423617
277 Ga0207683_10030992
278 Ga0207698_10003426
279 Ga0207698_10353088
280 Ga0207428_10029505
281 Ga0207428_10152068
282 Ga0307515_10102584
283 Ga0265313_10007940
284 Ga0307514_10042614
285 Ga0316579_10048564
286 Ga0307516_10074401
287 Ga0316577_10036334
288 Ga0316583_10102413
289 Ga0316592_1001156
290 Ga0316588_1002037
291 Ga0316596_1002492
292 Ga0316596_1022131
293 Ga0373944_0026443
294 Ga0373936_0001617
295 Ga0373953_0061606
296 Ga0373943_0003667
297 Ga0373955_0003289
298 Ga0373955_0197448
299 Ga0373961_0024909
300 Ga0373924_0025525
301 Ga0373935_0011689
302 Ga0373927_0038242
303 Ga0373947_0007013
304 Ga0373937_0027669
305 Ga0373937_0261832
306 Ga0373925_0012888
307 Ga0395905_0000025
308 Ga0395905_0020336
309 Ga0436365_1222321
310 Ga0451793_1580448
311 Ga0451577_0005033
312 Ga0466969_0057197
313 Ga0466965_0011600
314 Ga0466961_0054989
315 Ga0466963_0126272
316 Ga0466964_0011366
317 Ga0453684_0000014
318 Ga0453684_0017510
319 Ga0453684_0041523
320 Ga0453684_0043976
321 Ga0453684_0045765
322 Ga0466971_0000160
323 Ga0466968_0085403
324 Ga0466970_0035311
325 Ga0466957_0080782
326 Ga0451576_0006046
327 Ga0466958_0118081
328 Ga0495638_0310849
329 Ga0495618_0112248
330 Ga0495630_0003287
331 Ga0495630_0247580
332 Ga0495630_0476961
333 Ga0495632_0049831
334 Ga0495634_0289880
335 Ga0495658_0073293
336 Ga0495613_0072164
337 Ga0495674_0111949
338 Ga0495675_0143159
339 Ga0495675_0187765
340 Ga0496101_0431657
341 Ga0496102_0197205
342 Ga0496106_0116931
343 Ga0496106_0371343
344 Ga0496108_0545150
345 Ga0496109_0315273
346 Ga0496114_0031224
347 Ga0496116_0004409
348 Ga0496125_0011705
349 Ga0501081_0121096
350 nmdc:mga00v17_251892_c1
351 nmdc:mga00v17_2889_c1
352 nmdc:mga0yw44_158071_c1
353 nmdc:mga06z11_107524_c1
354 nmdc:mga04h51_166175_c1
355 nmdc:mga07m45_41499_c1
356 nmdc:mga05p37_240504_c1
357 nmdc:mga05p37_349_c1
358 nmdc:mga05p37_52457_c1
359 nmdc:mga09592_3199_c1
360 nmdc:mga0qj67_570_c1
361 nmdc:mga06r32_44784_c1
362 nmdc:mga08y16_9194_c1
363 nmdc:mga0n895_324725_c1
364 nmdc:mga0a205_285220_c1
365 Ga0495612_0003967
366 Ga0500644_0016573
367 Ga0500651_0278128
368 Ga0500650_0082686
369 Ga0500555_001332
370 Ga0500652_000443
371 Ga0500577_0015083
372 Ga0500616_0000135
373 Ga0500622_0000053
374 Ga0500645_002045
375 Ga0500599_005960
376 Ga0587070_022987
377 Ga0466962_0003972
378 2524191683
379 2644302842
380 2864739359
381 8055228538
382 8057475431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

274

297

0.95

PF00005

ABC_tran

ABC transporter

66

221

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.755 51 260
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.691 52 260
2awn-assembly1.cif.gz_A crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.6744 52 260
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.671 52 263
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.6681 52 261
ID Description Score Start End Superfamily
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9236 49 110 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7851 48 137 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7693 49 110 3.40.50.300
af_E9AGN0_737_1004_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7191 50 97 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6987 52 246 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2S3U666-F1-model_v4 Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD 0.768 49 252 GO:0005524
GO:0016887
AF-A0A7Z7PDD0-F1-model_v4 deleted 0.7384 49 155
AF-A0A127QVM3-F1-model_v4 Urea ABC transporter, ATP-binding protein UrtD 0.7066 45 264 GO:0005524
GO:0005886
GO:0016887
AF-A0A2D7KXY3-F1-model_v4 ABC transporter ATP-binding protein 0.6999 50 263 GO:0005524
GO:0005886
GO:0016887
AF-A0A355RLA1-F1-model_v4 Urea ABC transporter ATP-binding protein UrtD 0.6914 50 264 GO:0005524
GO:0005886
GO:0016887

Map