F294576

General Info

Members Datasets Scaffolds Average Seq Length
191 134 382 292

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0000298|Ga0495670_0000298_20968_21969
Length 333
Sequence MAAVMAVMVGTLSKIAIRRYTYLNSNGDNLRQTHQDTDMKINPKKFIVQEGKKVNLEKWPTLVKPFYKSKPKYEQMLAEQVAELSDLQQLHYASNKHALLLIFQSMDAGGKDSAIRHVMSGVNPQGCQVFSFKHPSETELEHDFLWRTAQCLPERGRIGIFNRSYYEEVLIVRVHPEILRSEGIPDGKVDEKTIWKERYDSIVAWEKHLCRNGTRIIKFFLHMSREEQRKRFLARLDEPDKNWKIEQADITERQFWNEYMRAYETCLGATSTKHAPWYVVPADDKQNARLIISQIIQNTFKALGMHYPTPDAERAEELSSIRSQLMAEAPESK

Samples

Sample ID Description Type Environment
1 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
75 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
76 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
96 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
134 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 0.52
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0.52
Rhizoplane 2.09
Rhizosphere 90.58
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495670_0000298 3300046691 Bacteria 23404
2 JGI25165J46597_1000181 3300003214 Bacteria 95569
3 rootH1_10091362 3300003316 Bacteria 1112
4 Ga0065715_10284163 3300005293 Bacteria 1079
5 Ga0070658_10323609 3300005327 Archaea 1317
6 Ga0070676_10076136 3300005328 Bacteria 2025
7 Ga0068868_100093154 3300005338 Bacteria 2429
8 Ga0070660_100007957 3300005339 Bacteria 7403
9 Ga0070661_100016098 3300005344 Bacteria 5277
10 Ga0070669_100048204 3300005353 Bacteria 3109
11 Ga0070675_100015497 3300005354 Bacteria 6028
12 Ga0070671_100073256 3300005355 Bacteria 2861
13 Ga0070673_100052095 3300005364 Bacteria 3210
14 Ga0070659_100003681 3300005366 Bacteria 10929
15 Ga0070713_100022582 3300005436 Bacteria 4864
16 Ga0070710_10021388 3300005437 Bacteria 3370
17 Ga0070711_100025032 3300005439 Bacteria 3901
18 Ga0070694_100000085 3300005444 Archaea 44866
19 Ga0070663_100006327 3300005455 Bacteria 7111
20 Ga0070662_100003169 3300005457 Bacteria 10222
21 Ga0070698_100001642 3300005471 Archaea 24941
22 Ga0070679_100116162 3300005530 Bacteria 2661
23 Ga0070697_100255062 3300005536 Unclassified 1500
24 Ga0068853_100001965 3300005539 Bacteria 15148
25 Ga0070672_100032274 3300005543 Bacteria 3950
26 Ga0068855_100000310 3300005563 Bacteria 60449
27 Ga0068855_100022399 3300005563 Bacteria 7572
28 Ga0068855_100039751 3300005563 Bacteria 5584
29 Ga0070664_100003222 3300005564 Bacteria 13200
30 Ga0068857_100091904 3300005577 Bacteria 2717
31 Ga0068854_100119259 3300005578 Bacteria 2000
32 Ga0068856_100002355 3300005614 Bacteria 19438
33 Ga0068856_100628059 3300005614 Bacteria 1095
34 Ga0068852_100026474 3300005616 Bacteria 4714
35 Ga0068859_100003590 3300005617 Bacteria 15807
36 Ga0068851_10142758 3300005834 Bacteria 1303
37 Ga0097620_100003590 3300006931 Bacteria 15807
38 Ga0105240_10041071 3300009093 Bacteria 5908
39 Ga0105248_10016738 3300009177 Bacteria 8072
40 Ga0105237_10071744 3300009545 Bacteria 3457
41 Ga0157373_10000647 3300013100 Bacteria 27419
42 Ga0157371_10001750 3300013102 Bacteria 22003
43 Ga0157371_10182923 3300013102 Bacteria 1499
44 Ga0157369_10204140 3300013105 Bacteria 2073
45 Ga0157369_10407854 3300013105 Bacteria 1409
46 Ga0157369_10583553 3300013105 Bacteria 1154
47 Ga0163162_10218724 3300013306 Bacteria 2035
48 Ga0157372_10000593 3300013307 Bacteria 39451
49 Ga0213872_10000405 3300021361 Bacteria 35574
50 Ga0207427_105699 3300025231 Bacteria 1704
51 Ga0209233_1000045 3300025261 Bacteria 473379
52 Ga0209233_1008700 3300025261 Bacteria 3121
53 Ga0209257_1012921 3300025304 Bacteria 3781
54 Ga0207705_10189673 3300025909 Bacteria 1554
55 Ga0207695_10067358 3300025913 Bacteria 3673
56 Ga0207693_10022020 3300025915 Bacteria 5067
57 Ga0207657_10000510 3300025919 Bacteria 41051
58 Ga0207649_10128925 3300025920 Bacteria 1716
59 Ga0207652_10113526 3300025921 Bacteria 2405
60 Ga0207681_10068072 3300025923 Bacteria 2471
61 Ga0207694_10098417 3300025924 Bacteria 2316
62 Ga0207687_10290897 3300025927 Bacteria 1313
63 Ga0207644_10006418 3300025931 Bacteria 7664
64 Ga0207690_10000725 3300025932 Bacteria 21280
65 Ga0207690_10148641 3300025932 Bacteria 1735
66 Ga0207706_10000093 3300025933 Bacteria 93173
67 Ga0207691_10092657 3300025940 Bacteria 2706
68 Ga0207711_10155733 3300025941 Bacteria 2065
69 Ga0207679_10012057 3300025945 Bacteria 5622
70 Ga0207667_10003071 3300025949 Bacteria 20698
71 Ga0207667_10090561 3300025949 Bacteria 3161
72 Ga0207667_10141204 3300025949 Bacteria 2479
73 Ga0207640_10065781 3300025981 Bacteria 2420
74 Ga0207677_10293199 3300026023 Bacteria 1341
75 Ga0207703_10111822 3300026035 Bacteria 2332
76 Ga0207639_10506053 3300026041 Bacteria 1104
77 Ga0207702_10004987 3300026078 Bacteria 11661
78 Ga0207702_10356591 3300026078 Bacteria 1401
79 Ga0207674_10090434 3300026116 Bacteria 3052
80 Ga0207698_10018377 3300026142 Bacteria 4762
81 Ga0265337_1041149 3300028556 Bacteria 1330
82 Ga0265319_1000086 3300028563 Bacteria 72711
83 Ga0265319_1000427 3300028563 Bacteria 30352
84 Ga0265318_10000143 3300028577 Bacteria 64628
85 Ga0265318_10001952 3300028577 Bacteria 11479
86 Ga0265338_10004195 3300028800 Bacteria 19656
87 Ga0265338_10004571 3300028800 Bacteria 18621
88 Ga0265338_10037067 3300028800 Bacteria 4649
89 Ga0265338_10045357 3300028800 Bacteria 4044
90 Ga0265338_10180436 3300028800 Bacteria 1610
91 Ga0265324_10000766 3300029957 Bacteria 21156
92 Ga0307511_10117601 3300030521 Bacteria 1660
93 Ga0265760_10008504 3300031090 Bacteria 2935
94 Ga0265330_10000805 3300031235 Bacteria 19763
95 Ga0265330_10015097 3300031235 Bacteria 3576
96 Ga0265330_10073470 3300031235 Bacteria 1479
97 Ga0265332_10000167 3300031238 Bacteria 53640
98 Ga0265328_10012849 3300031239 Bacteria 3327
99 Ga0265320_10000318 3300031240 Bacteria 39227
100 Ga0265320_10004069 3300031240 Bacteria 9606
101 Ga0265320_10037447 3300031240 Bacteria 2443
102 Ga0265320_10053333 3300031240 Bacteria 1955
103 Ga0265329_10000918 3300031242 Bacteria 14809
104 Ga0265340_10004630 3300031247 Bacteria 7657
105 Ga0265340_10009427 3300031247 Bacteria 5239
106 Ga0265340_10097685 3300031247 Bacteria 1367
107 Ga0265339_10000190 3300031249 Bacteria 51604
108 Ga0265339_10000392 3300031249 Bacteria 34517
109 Ga0265339_10006346 3300031249 Bacteria 7772
110 Ga0265339_10012255 3300031249 Bacteria 5242
111 Ga0265331_10001958 3300031250 Bacteria 14382
112 Ga0265327_10026849 3300031251 Bacteria 3326
113 Ga0265316_10005444 3300031344 Bacteria 12371
114 Ga0265316_10009460 3300031344 Bacteria 8977
115 Ga0265316_10009501 3300031344 Bacteria 8956
116 Ga0265316_10011251 3300031344 Bacteria 8091
117 Ga0265316_10024178 3300031344 Bacteria 5097
118 Ga0265316_10033191 3300031344 Bacteria 4206
119 Ga0265316_10062719 3300031344 Bacteria 2884
120 Ga0265316_10169949 3300031344 Bacteria 1627
121 Ga0265316_10354350 3300031344 Bacteria 1062
122 Ga0307509_10000022 3300031507 Bacteria 247822
123 Ga0265313_10000252 3300031595 Bacteria 58494
124 Ga0265313_10000279 3300031595 Bacteria 55931
125 Ga0265313_10003040 3300031595 Bacteria 13940
126 Ga0307508_10081934 3300031616 Bacteria 2808
127 Ga0265314_10000632 3300031711 Bacteria 43168
128 Ga0265314_10001821 3300031711 Bacteria 22936
129 Ga0265314_10007983 3300031711 Bacteria 9128
130 Ga0265314_10231325 3300031711 Bacteria 1072
131 Ga0265342_10000081 3300031712 Bacteria 104184
132 Ga0265342_10001925 3300031712 Bacteria 18643
133 Ga0265342_10049252 3300031712 Bacteria 2522
134 Ga0265342_10129837 3300031712 Bacteria 1413
135 Ga0307516_10149066 3300031730 Bacteria 2102
136 Ga0316215_1000463 3300033544 Bacteria 4662
137 Ga0373936_0019027 3300035113 Bacteria 2659
138 Ga0373941_0056950 3300035115 Bacteria 1261
139 Ga0373960_0014839 3300035121 Bacteria 1980
140 Ga0395905_0000110 3300037471 Bacteria 137078
141 Ga0395905_0015756 3300037471 Bacteria 7181
142 Ga0436361_0729108 3300039447 Bacteria 59083
143 Ga0451577_0149492 3300042876 Bacteria 2101
144 Ga0453684_0014546 3300044712 Bacteria 12565
145 Ga0495617_000571 3300046452 Bacteria 18932
146 Ga0495592_0140827 3300046454 Bacteria 1678
147 Ga0495580_0046097 3300046472 Bacteria 3095
148 Ga0495580_0338478 3300046472 Bacteria 1021
149 Ga0495584_0000244 3300046491 Bacteria 39436
150 Ga0495584_0000536 3300046491 Bacteria 25714
151 Ga0495584_0023896 3300046491 Bacteria 3099
152 Ga0495585_0000260 3300046492 Bacteria 54082
153 Ga0495585_0000502 3300046492 Bacteria 37062
154 Ga0495585_0012395 3300046492 Bacteria 5024
155 Ga0495585_0173881 3300046492 Bacteria 1110
156 Ga0495583_0000064 3300046506 Bacteria 192380
157 Ga0495583_0001725 3300046506 Bacteria 20966
158 Ga0495606_0034035 3300046507 Bacteria 3504
159 Ga0495606_0205349 3300046507 Bacteria 1120
160 Ga0495616_0002578 3300046513 Bacteria 11933
161 Ga0495616_0007386 3300046513 Bacteria 6574
162 Ga0495648_0000079 3300046524 Bacteria 126099
163 Ga0495645_0031951 3300046543 Bacteria 3838
164 Ga0495633_0004769 3300046558 Bacteria 8505
165 Ga0495668_0004616 3300046616 Bacteria 9685
166 Ga0495661_0009089 3300046665 Bacteria 6832
167 Ga0495588_0003161 3300046674 Bacteria 7129
168 Ga0495670_0004085 3300046691 Bacteria 7160
169 Ga0495683_0000064 3300047323 Bacteria 112558
170 Ga0495683_0054298 3300047323 Bacteria 1997
171 Ga0495687_061978 3300047443 Bacteria 1537
172 Ga0496102_0007657 3300048905 Bacteria 9226
173 Ga0496103_0033405 3300048906 Bacteria 3143
174 Ga0496106_0097058 3300048909 Bacteria 2281
175 Ga0496107_0053856 3300048910 Bacteria 2902
176 Ga0496119_0030948 3300048922 Bacteria 3598
177 Ga0495682_0005820 3300049460 Bacteria 5068
178 Ga0501032_0304174 3300049569 Bacteria 1031
179 Ga0501034_0001678 3300049571 Bacteria 28539
180 Ga0501034_0090395 3300049571 Bacteria 3059
181 Ga0501046_0018983 3300049580 Bacteria 5707
182 Ga0501046_0147418 3300049580 Bacteria 1776
183 Ga0501070_0000804 3300049586 Bacteria 28510
184 Ga0501073_0025373 3300049589 Bacteria 4251
185 Ga0501079_0019704 3300049741 Bacteria 5153
186 Ga0501083_0000368 3300049744 Bacteria 28496
187 nmdc:mga0qj67_300540_c1 3300050509 Bacteria 1300
188 Ga0500618_001221 3300053125 Bacteria 12075
189 Ga0501082_0000749 3300060353 Bacteria 28536
190 2514047626 2513237166 Bacteria 10373764
191 2919143016 2919138771 Bacteria 5281312
192 Ga0495670_0000298
193 JGI25165J46597_1000181
194 rootH1_10091362
195 Ga0065715_10284163
196 Ga0070658_10323609
197 Ga0070676_10076136
198 Ga0068868_100093154
199 Ga0070660_100007957
200 Ga0070661_100016098
201 Ga0070669_100048204
202 Ga0070675_100015497
203 Ga0070671_100073256
204 Ga0070673_100052095
205 Ga0070659_100003681
206 Ga0070713_100022582
207 Ga0070710_10021388
208 Ga0070711_100025032
209 Ga0070694_100000085
210 Ga0070663_100006327
211 Ga0070662_100003169
212 Ga0070698_100001642
213 Ga0070679_100116162
214 Ga0070697_100255062
215 Ga0068853_100001965
216 Ga0070672_100032274
217 Ga0068855_100000310
218 Ga0068855_100022399
219 Ga0068855_100039751
220 Ga0070664_100003222
221 Ga0068857_100091904
222 Ga0068854_100119259
223 Ga0068856_100002355
224 Ga0068856_100628059
225 Ga0068852_100026474
226 Ga0068859_100003590
227 Ga0068851_10142758
228 Ga0097620_100003590
229 Ga0105240_10041071
230 Ga0105248_10016738
231 Ga0105237_10071744
232 Ga0157373_10000647
233 Ga0157371_10001750
234 Ga0157371_10182923
235 Ga0157369_10204140
236 Ga0157369_10407854
237 Ga0157369_10583553
238 Ga0163162_10218724
239 Ga0157372_10000593
240 Ga0213872_10000405
241 Ga0207427_105699
242 Ga0209233_1000045
243 Ga0209233_1008700
244 Ga0209257_1012921
245 Ga0207705_10189673
246 Ga0207695_10067358
247 Ga0207693_10022020
248 Ga0207657_10000510
249 Ga0207649_10128925
250 Ga0207652_10113526
251 Ga0207681_10068072
252 Ga0207694_10098417
253 Ga0207687_10290897
254 Ga0207644_10006418
255 Ga0207690_10000725
256 Ga0207690_10148641
257 Ga0207706_10000093
258 Ga0207691_10092657
259 Ga0207711_10155733
260 Ga0207679_10012057
261 Ga0207667_10003071
262 Ga0207667_10090561
263 Ga0207667_10141204
264 Ga0207640_10065781
265 Ga0207677_10293199
266 Ga0207703_10111822
267 Ga0207639_10506053
268 Ga0207702_10004987
269 Ga0207702_10356591
270 Ga0207674_10090434
271 Ga0207698_10018377
272 Ga0265337_1041149
273 Ga0265319_1000086
274 Ga0265319_1000427
275 Ga0265318_10000143
276 Ga0265318_10001952
277 Ga0265338_10004195
278 Ga0265338_10004571
279 Ga0265338_10037067
280 Ga0265338_10045357
281 Ga0265338_10180436
282 Ga0265324_10000766
283 Ga0307511_10117601
284 Ga0265760_10008504
285 Ga0265330_10000805
286 Ga0265330_10015097
287 Ga0265330_10073470
288 Ga0265332_10000167
289 Ga0265328_10012849
290 Ga0265320_10000318
291 Ga0265320_10004069
292 Ga0265320_10037447
293 Ga0265320_10053333
294 Ga0265329_10000918
295 Ga0265340_10004630
296 Ga0265340_10009427
297 Ga0265340_10097685
298 Ga0265339_10000190
299 Ga0265339_10000392
300 Ga0265339_10006346
301 Ga0265339_10012255
302 Ga0265331_10001958
303 Ga0265327_10026849
304 Ga0265316_10005444
305 Ga0265316_10009460
306 Ga0265316_10009501
307 Ga0265316_10011251
308 Ga0265316_10024178
309 Ga0265316_10033191
310 Ga0265316_10062719
311 Ga0265316_10169949
312 Ga0265316_10354350
313 Ga0307509_10000022
314 Ga0265313_10000252
315 Ga0265313_10000279
316 Ga0265313_10003040
317 Ga0307508_10081934
318 Ga0265314_10000632
319 Ga0265314_10001821
320 Ga0265314_10007983
321 Ga0265314_10231325
322 Ga0265342_10000081
323 Ga0265342_10001925
324 Ga0265342_10049252
325 Ga0265342_10129837
326 Ga0307516_10149066
327 Ga0316215_1000463
328 Ga0373936_0019027
329 Ga0373941_0056950
330 Ga0373960_0014839
331 Ga0395905_0000110
332 Ga0395905_0015756
333 Ga0436361_0729108
334 Ga0451577_0149492
335 Ga0453684_0014546
336 Ga0495617_000571
337 Ga0495592_0140827
338 Ga0495580_0046097
339 Ga0495580_0338478
340 Ga0495584_0000244
341 Ga0495584_0000536
342 Ga0495584_0023896
343 Ga0495585_0000260
344 Ga0495585_0000502
345 Ga0495585_0012395
346 Ga0495585_0173881
347 Ga0495583_0000064
348 Ga0495583_0001725
349 Ga0495606_0034035
350 Ga0495606_0205349
351 Ga0495616_0002578
352 Ga0495616_0007386
353 Ga0495648_0000079
354 Ga0495645_0031951
355 Ga0495633_0004769
356 Ga0495668_0004616
357 Ga0495661_0009089
358 Ga0495588_0003161
359 Ga0495670_0004085
360 Ga0495683_0000064
361 Ga0495683_0054298
362 Ga0495687_061978
363 Ga0496102_0007657
364 Ga0496103_0033405
365 Ga0496106_0097058
366 Ga0496107_0053856
367 Ga0496119_0030948
368 Ga0495682_0005820
369 Ga0501032_0304174
370 Ga0501034_0001678
371 Ga0501034_0090395
372 Ga0501046_0018983
373 Ga0501046_0147418
374 Ga0501070_0000804
375 Ga0501073_0025373
376 Ga0501079_0019704
377 Ga0501083_0000368
378 nmdc:mga0qj67_300540_c1
379 Ga0500618_001221
380 Ga0501082_0000749
381 2514047626
382 2919143016

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03976

PPK2

Polyphosphate kinase 2 (PPK2)

67

307

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o6m-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9593 6 269
7bmm-assembly2.cif.gz_C crystal structure of polyphosphate kinase 2 from deinococcus radiodurans in apo form 0.9592 3 271
5lcd-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber bound to amp 0.9568 6 269
5o6m-assembly1.cif.gz_C structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9539 8 271
5o6k-assembly1.cif.gz_D structure of polyphosphate kinase from meiothermus ruber n121d 0.9523 8 271
ID Description Score Start End Superfamily
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9588 4 271 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.953 6 271 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9355 6 271 3.40.50.300
6angA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9279 5 286 3.40.50.300
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9241 4 271 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3C1MUX3-F1-model_v4 Phosphate--nucleotide phosphotransferase 0.9854 1 128 GO:0016740
AF-A0A351G5K1-F1-model_v4 Phosphate--nucleotide phosphotransferase 0.9757 42 286 GO:0006797
GO:0008976
AF-M1QDU0-F1-model_v4 Polyphosphate kinase-2-related domain-containing protein 0.973 5 285 GO:0006797
GO:0016020
GO:0016776
AF-A0A7D5EAK9-F1-model_v4 Polyphosphate kinase 2 family protein 0.9723 5 285 GO:0006797
GO:0008976
AF-A0A7Y2GT93-F1-model_v4 Polyphosphate kinase 2 family protein 0.9711 3 286 GO:0006797
GO:0008976

Map